Viewing data for Apeltes quadracus


Scientific name Apeltes quadracus
Common name Fourspine stickleback
Maximum lifespan 3.00 years (Apeltes quadracus@AnAge)

Total mtDNA (size: 16472 bases) GC AT G C A T
Base content (bases) 7389 9083 4632 2757 4537 4546
Base content per 1 kb (bases) 449 551 281 167 275 276
Base content (%) 44.9% 55.1%
Total protein-coding genes (size: 11411 bases) GC AT G C A T
Base content (bases) 5103 6308 3392 1711 3338 2970
Base content per 1 kb (bases) 447 553 297 150 293 260
Base content (%) 44.7% 55.3%
D-loop (size: 831 bases) GC AT G C A T
Base content (bases) 336 495 182 154 250 245
Base content per 1 kb (bases) 404 596 219 185 301 295
Base content (%) 40.4% 59.6%
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 723 822 399 324 365 457
Base content per 1 kb (bases) 468 532 258 210 236 296
Base content (%) 46.8% 53.2%
Total rRNA-coding genes (size: 2625 bases) GC AT G C A T
Base content (bases) 1201 1424 640 561 574 850
Base content per 1 kb (bases) 458 542 244 214 219 324
Base content (%) 45.8% 54.2%
12S rRNA gene (size: 942 bases) GC AT G C A T
Base content (bases) 445 497 237 208 196 301
Base content per 1 kb (bases) 472 528 252 221 208 320
Base content (%) 47.2% 52.8%
16S rRNA gene (size: 1683 bases) GC AT G C A T
Base content (bases) 756 927 403 353 378 549
Base content per 1 kb (bases) 449 551 239 210 225 326
Base content (%) 44.9% 55.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 301 383 211 90 207 176
Base content per 1 kb (bases) 440 560 308 132 303 257
Base content (%) 44.0% 56.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 52 17 46 53
Base content per 1 kb (bases) 411 589 310 101 274 315
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 715 836 435 280 459 377
Base content per 1 kb (bases) 461 539 280 181 296 243
Base content (%) 46.1% 53.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 290 401 184 106 201 200
Base content per 1 kb (bases) 420 580 266 153 291 289
Base content (%) 42.0% 58.0%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 374 412 238 136 230 182
Base content per 1 kb (bases) 476 524 303 173 293 232
Base content (%) 47.6% 52.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 513 628 337 176 349 279
Base content per 1 kb (bases) 450 550 295 154 306 245
Base content (%) 45.0% 55.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 426 549 289 137 314 235
Base content per 1 kb (bases) 437 563 296 141 322 241
Base content (%) 43.7% 56.3%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 474 573 342 132 298 275
Base content per 1 kb (bases) 453 547 327 126 285 263
Base content (%) 45.3% 54.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 163 188 105 58 108 80
Base content per 1 kb (bases) 464 536 299 165 308 228
Base content (%) 46.4% 53.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 609 772 411 198 403 369
Base content per 1 kb (bases) 441 559 298 143 292 267
Base content (%) 44.1% 55.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 90 45 96 66
Base content per 1 kb (bases) 455 545 303 152 323 222
Base content (%) 45.5% 54.5%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 799 1040 531 268 554 486
Base content per 1 kb (bases) 434 566 289 146 301 264
Base content (%) 43.4% 56.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 240 282 170 70 80 202
Base content per 1 kb (bases) 460 540 326 134 153 387
Base content (%) 46.0% 54.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 21 (9.25%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 6 (2.64%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 5 15 12 11 1 13 8 1 3 3 7 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 7 5 9 0 1 5 3 2 5 6 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 1 1 3 2 0 0 4 1 2 0 1 7 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 0 1 1 0 1 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 75 59 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 73 82 62
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFAMLIFSWLVFLIIIPSKVMAHIFHSEPTMQSAEKRLTNPWTWPWP*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 0 2 2 0 1 2 0 1 1 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 1 0 0 0 0 0 0 2 3 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 0 2 0 0 2 0 0 1 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 2 0 1 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 18 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 17 11 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 18 24 12
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 32 (6.2%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 15 14 16 10 19 6 8 7 1 16 14 9 3 14 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 13 14 19 0 7 18 13 9 12 8 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 4 9 8 10 0 0 5 3 15 3 3 3 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 4 5 9 8 0 1 0 7 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 114 127 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 184 156 135
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 15 (6.55%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 24 (10.48%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 13 (5.68%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 8 (3.49%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 8 9 3 7 0 6 7 1 7 3 3 2 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 5 6 0 3 1 5 0 4 6 2 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 3 4 6 0 2 1 5 4 0 1 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 2 4 10 3 1 1 4 2 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 56 62 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 56 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 72 76 69
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.43%)
Alanine (Ala, A)
n = 21 (8.05%)
Serine (Ser, S)
n = 15 (5.75%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 13 (4.98%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 24 (9.2%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 4 7 9 7 7 2 7 7 2 7 7 2 0 7 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 9 6 6 0 4 8 8 2 3 8 1 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 1 7 2 3 0 0 3 3 8 2 0 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 5 0 5 1 1 0 2 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 69 50 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 69 55 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 100 77 68
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 30 (7.92%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 20 6 17 15 16 0 11 7 1 9 9 6 4 14 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 9 11 10 1 6 9 9 4 5 10 4 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 3 8 4 7 2 0 1 5 10 2 1 6 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 5 5 9 0 1 1 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 96 89 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 95 78 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 146 112 99
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 63 (19.44%)
Isoleucine (Ile, I)
n = 28 (8.64%)
Methionine (Met, M)
n = 8 (2.47%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 11 7 16 12 11 2 19 5 2 8 5 4 1 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 14 13 5 1 4 7 5 2 6 12 6 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 1 5 9 3 0 0 3 6 5 0 3 1 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 0 4 6 1 2 0 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 85 78 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 57 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 109 100 100
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.46%)
Alanine (Ala, A)
n = 35 (10.06%)
Serine (Ser, S)
n = 26 (7.47%)
Threonine (Thr, T)
n = 45 (12.93%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 76 (21.84%)
Isoleucine (Ile, I)
n = 19 (5.46%)
Methionine (Met, M)
n = 13 (3.74%)
Proline (Pro, P)
n = 22 (6.32%)
Phenylalanine (Phe, F)
n = 15 (4.31%)
Tyrosine (Tyr, Y)
n = 6 (1.72%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 12 (3.45%)
Histidine (His, H)
n = 10 (2.87%)
Lysine (Lys, K)
n = 8 (2.3%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 8 26 11 18 8 10 11 1 3 3 3 1 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 7 15 13 0 5 6 8 0 7 9 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 14 0 6 8 7 1 3 1 3 3 1 3 2 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 1 1 7 1 1 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 111 99 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 124 54 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 107 122 97
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.46%)
Alanine (Ala, A)
n = 35 (10.06%)
Serine (Ser, S)
n = 26 (7.47%)
Threonine (Thr, T)
n = 45 (12.93%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 76 (21.84%)
Isoleucine (Ile, I)
n = 19 (5.46%)
Methionine (Met, M)
n = 13 (3.74%)
Proline (Pro, P)
n = 22 (6.32%)
Phenylalanine (Phe, F)
n = 15 (4.31%)
Tyrosine (Tyr, Y)
n = 6 (1.72%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 12 (3.45%)
Histidine (His, H)
n = 10 (2.87%)
Lysine (Lys, K)
n = 8 (2.3%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 8 26 11 18 8 10 11 1 3 3 3 1 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 7 15 13 0 5 6 8 0 7 9 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 14 0 6 8 7 1 3 1 3 3 1 3 2 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 1 1 7 1 1 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 111 99 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 124 54 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 107 122 97
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (5.23%)
Alanine (Ala, A)
n = 36 (7.84%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 47 (10.24%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 20 (4.36%)
Leucine (Leu, L)
n = 98 (21.35%)
Isoleucine (Ile, I)
n = 33 (7.19%)
Methionine (Met, M)
n = 21 (4.58%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 15 (3.27%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 17 13 28 19 27 6 14 10 1 8 4 8 0 13 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 3 9 16 11 0 4 8 8 4 4 15 5 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 1 5 10 4 1 4 5 7 7 4 4 3 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 0 7 8 1 2 1 7 1 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 136 134 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 127 77 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 148 158 121
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 2 5 5 7 1 5 4 0 2 0 0 0 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 7 5 2 0 0 4 2 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 3 3 1 1 0 0 0 0 1 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 30 16 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 31 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 29 34 30
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.56%)
Alanine (Ala, A)
n = 53 (8.66%)
Serine (Ser, S)
n = 56 (9.15%)
Threonine (Thr, T)
n = 56 (9.15%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 34 (5.56%)
Leucine (Leu, L)
n = 88 (14.38%)
Isoleucine (Ile, I)
n = 43 (7.03%)
Methionine (Met, M)
n = 28 (4.58%)
Proline (Pro, P)
n = 27 (4.41%)
Phenylalanine (Phe, F)
n = 51 (8.33%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 24 (3.92%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 19 (3.1%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 18 15 24 19 21 4 17 17 2 10 12 11 1 32 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 3 4 9 29 14 1 6 13 13 2 6 13 8 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 4 18 9 12 3 4 10 4 5 1 3 2 22 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 4 4 9 15 4 3 2 6 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 139 184 144
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 178 111 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 214 191 166
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.29%)
Alanine (Ala, A)
n = 14 (8.09%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 28 (16.18%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 2 8 0 3 1 9 0 0 11 1 6 10 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 7 0 4 3 6 2 1 14 2 1 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 6 1 4 0 3 2 9 0 4 7 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 1 2 0 0 1 0 0 2 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 22 23 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 35 23 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 13 34 71
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.48%)
Alanine (Ala, A)
n = 330 (8.66%)
Serine (Ser, S)
n = 263 (6.9%)
Threonine (Thr, T)
n = 309 (8.11%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 238 (6.25%)
Leucine (Leu, L)
n = 642 (16.85%)
Isoleucine (Ile, I)
n = 262 (6.88%)
Methionine (Met, M)
n = 147 (3.86%)
Proline (Pro, P)
n = 213 (5.59%)
Phenylalanine (Phe, F)
n = 246 (6.46%)
Tyrosine (Tyr, Y)
n = 107 (2.81%)
Tryptophan (Trp, W)
n = 119 (3.12%)
Aspartic acid (Asp, D)
n = 79 (2.07%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 118 (3.1%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 107 (2.81%)
Lysine (Lys, K)
n = 71 (1.86%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
146 116 91 179 121 155 32 126 88 12 87 63 63 25 126 120
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 11 14 100 123 101 6 46 83 76 42 58 97 51 7 72
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
117 105 15 72 66 63 8 17 37 47 60 18 29 28 90 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 71 30 22 57 61 10 14 13 44 5 0 0 8 2 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
995 983 961 871
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
521 1061 693 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
297 1251 1204 1058

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.