Viewing data for Aotus lemurinus


Scientific name Aotus lemurinus
Common name Lemurine night monkey
Maximum lifespan 33.80 years (Aotus lemurinus@AnAge)

Total mtDNA (size: 16580 bases) GC AT G C A T
Base content (bases) 6458 10122 4332 2126 4713 5409
Base content per 1 kb (bases) 390 610 261 128 284 326
Base content (%) 39.0% 61.0%
Total protein-coding genes (size: 11337 bases) GC AT G C A T
Base content (bases) 4398 6939 3093 1305 3353 3586
Base content per 1 kb (bases) 388 612 273 115 296 316
Base content (%) 38.8% 61.2%
D-loop (size: 1161 bases) GC AT G C A T
Base content (bases) 478 683 318 160 305 378
Base content per 1 kb (bases) 412 588 274 138 263 326
Base content (%) 41.2% 58.8%
Total tRNA-coding genes (size: 1501 bases) GC AT G C A T
Base content (bases) 538 963 317 221 422 541
Base content per 1 kb (bases) 358 642 211 147 281 360
Base content (%) 35.8% 64.2%
Total rRNA-coding genes (size: 2510 bases) GC AT G C A T
Base content (bases) 1019 1491 586 433 609 882
Base content per 1 kb (bases) 406 594 233 173 243 351
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 400 556 222 178 228 328
Base content per 1 kb (bases) 418 582 232 186 238 343
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1554 bases) GC AT G C A T
Base content (bases) 619 935 364 255 381 554
Base content per 1 kb (bases) 398 602 234 164 245 356
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 258 423 187 71 206 217
Base content per 1 kb (bases) 379 621 275 104 302 319
Base content (%) 37.9% 62.1%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 58 143 44 14 62 81
Base content per 1 kb (bases) 289 711 219 70 308 403
Base content (%) 28.9% 71.1%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 629 928 383 246 485 443
Base content per 1 kb (bases) 404 596 246 158 311 285
Base content (%) 40.4% 59.6%
COX2 (size: 674 bases) GC AT G C A T
Base content (bases) 269 405 180 89 192 213
Base content per 1 kb (bases) 399 601 267 132 285 316
Base content (%) 39.9% 60.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 225 115 224 220
Base content per 1 kb (bases) 434 566 287 147 286 281
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 462 678 328 134 346 332
Base content per 1 kb (bases) 405 595 288 118 304 291
Base content (%) 40.5% 59.5%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 371 584 270 101 282 302
Base content per 1 kb (bases) 388 612 283 106 295 316
Base content (%) 38.8% 61.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 362 677 279 83 308 369
Base content per 1 kb (bases) 348 652 269 80 296 355
Base content (%) 34.8% 65.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 133 213 91 42 105 108
Base content per 1 kb (bases) 384 616 263 121 303 312
Base content (%) 38.4% 61.6%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 503 872 369 134 424 448
Base content per 1 kb (bases) 366 634 268 97 308 326
Base content (%) 36.6% 63.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 104 193 68 36 105 88
Base content per 1 kb (bases) 350 650 229 121 354 296
Base content (%) 35.0% 65.0%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 712 1094 523 189 519 575
Base content per 1 kb (bases) 394 606 290 105 287 318
Base content (%) 39.4% 60.6%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 210 324 155 55 113 211
Base content per 1 kb (bases) 393 607 290 103 212 395
Base content (%) 39.3% 60.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 11 9 4 17 4 11 9 0 3 2 7 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 5 7 1 1 2 5 1 3 5 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 6 4 3 0 0 2 2 2 1 1 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 1 3 2 0 0 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 64 80 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 62 40 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 61 97 56
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDISPWPMVILSMIVALFYFIQLKLLNFTFHSIPSSKPMKTQKHKTTWELKWTKIYLPLSTYQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 6 (9.09%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 1 (1.52%)
Glutamine (Gln, Q)
n = 4 (6.06%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 3 1 0 4 1 3 3 1 0 0 1 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 0 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 1 0 4 0 1 0 2 1 0 0 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 25 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 18 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 8 36 18
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 38 (7.34%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.37%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 42 (8.11%)
Methionine (Met, M)
n = 30 (5.79%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.47%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 11 25 12 6 26 5 12 7 0 7 7 16 3 19 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 18 13 1 11 11 21 3 8 8 9 3 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 8 8 15 0 1 3 15 6 2 0 7 11 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 8 6 9 2 2 1 5 0 0 1 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 110 145 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 100 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 137 198 156
COX2 (size: 674 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.59%)
Alanine (Ala, A)
n = 16 (7.17%)
Serine (Ser, S)
n = 17 (7.62%)
Threonine (Thr, T)
n = 16 (7.17%)
Cysteine (Cys, C)
n = 2 (0.9%)
Valine (Val, V)
n = 7 (3.14%)
Leucine (Leu, L)
n = 29 (13.0%)
Isoleucine (Ile, I)
n = 23 (10.31%)
Methionine (Met, M)
n = 13 (5.83%)
Proline (Pro, P)
n = 12 (5.38%)
Phenylalanine (Phe, F)
n = 11 (4.93%)
Tyrosine (Tyr, Y)
n = 11 (4.93%)
Tryptophan (Trp, W)
n = 5 (2.24%)
Aspartic acid (Asp, D)
n = 10 (4.48%)
Glutamic acid (Glu, E)
n = 14 (6.28%)
Asparagine (Asn, N)
n = 6 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.59%)
Histidine (His, H)
n = 6 (2.69%)
Lysine (Lys, K)
n = 4 (1.79%)
Arginine (Arg, R)
n = 6 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 12 8 3 11 2 5 6 2 3 2 2 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 8 3 5 0 1 4 3 0 3 3 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 2 2 3 7 1 0 4 6 5 0 0 2 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 14 0 4 6 4 0 2 2 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 56 66 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 67 87 61
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 15 (5.77%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 10 6 5 12 1 3 9 0 3 3 6 0 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 5 10 7 0 1 9 9 1 1 6 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 5 4 5 0 1 4 7 8 0 0 3 1 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 1 1 2 2 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 66 62 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 73 57 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 86 101 67
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 36 (9.5%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 13 (3.43%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 16 13 7 22 4 9 8 0 4 2 7 0 12 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 9 6 0 4 9 8 2 2 13 8 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 0 6 10 9 0 1 2 8 6 0 0 7 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 4 8 7 3 0 2 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 96 120 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 74 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 126 138 103
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 26 (8.2%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 58 (18.3%)
Isoleucine (Ile, I)
n = 25 (7.89%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 19 10 6 32 0 10 6 0 4 2 5 1 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 13 13 0 2 8 2 0 5 8 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 5 5 12 0 0 2 6 6 0 0 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 0 2 1 7 0 0 1 6 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 86 93 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 97 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 87 152 76
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 16 (4.64%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 32 (9.28%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 40 (11.59%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 36 9 8 28 2 13 8 1 1 0 7 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 7 5 0 2 3 6 1 3 10 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 3 13 11 0 1 3 4 7 0 1 9 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 11 1 0 2 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 86 140 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 98 61 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 95 168 72
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 16 (4.64%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 32 (9.28%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 40 (11.59%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 36 9 8 28 2 13 8 1 1 0 7 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 7 5 0 2 3 6 1 3 10 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 3 13 11 0 1 3 4 7 0 1 9 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 11 1 0 2 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 86 140 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 98 61 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 95 168 72
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.38%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 35 (7.66%)
Threonine (Thr, T)
n = 43 (9.41%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 93 (20.35%)
Isoleucine (Ile, I)
n = 38 (8.32%)
Methionine (Met, M)
n = 43 (9.41%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 21 (4.6%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 21 (4.6%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 10 39 12 19 32 3 26 7 1 5 1 2 0 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 4 15 7 0 4 10 4 2 7 8 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 1 6 7 14 0 2 6 6 9 0 1 12 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 0 2 1 10 2 1 1 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 121 165 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 122 79 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 126 204 114
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 6 (6.12%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 7 2 1 16 3 5 2 0 2 1 2 2 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 3 3 0 2 1 1 0 2 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 1 3 2 0 0 0 4 2 0 0 4 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 29 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 19 19 53
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 20 45 27
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 39 (6.49%)
Serine (Ser, S)
n = 61 (10.15%)
Threonine (Thr, T)
n = 63 (10.48%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 16 (2.66%)
Leucine (Leu, L)
n = 88 (14.64%)
Isoleucine (Ile, I)
n = 62 (10.32%)
Methionine (Met, M)
n = 33 (5.49%)
Proline (Pro, P)
n = 26 (4.33%)
Phenylalanine (Phe, F)
n = 45 (7.49%)
Tyrosine (Tyr, Y)
n = 13 (2.16%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 9 (1.5%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 30 (4.99%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 18 (3.0%)
Lysine (Lys, K)
n = 19 (3.16%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 32 33 17 11 42 6 12 17 3 4 3 9 0 17 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 1 9 13 16 1 3 11 9 3 4 11 11 0 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 27 1 10 14 17 3 3 14 5 8 2 0 9 21 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 6 3 16 3 1 5 2 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 148 224 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 172 120 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 203 231 145
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 12 (6.78%)
Serine (Ser, S)
n = 9 (5.08%)
Threonine (Thr, T)
n = 12 (6.78%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 17 (9.6%)
Leucine (Leu, L)
n = 20 (11.3%)
Isoleucine (Ile, I)
n = 13 (7.34%)
Methionine (Met, M)
n = 16 (9.04%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 9 (5.08%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 4 (2.26%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 3 (1.69%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 9 1 0 1 1 7 0 0 8 0 2 7 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 7 1 0 4 15 0 2 8 5 0 0 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 4 3 0 1 1 4 0 10 0 0 10 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 5 2 2 0 3 1 0 0 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 13 51 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 35 31 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 7 31 88
Total protein-coding genes (size: 11389 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 208 (5.48%)
Alanine (Ala, A)
n = 253 (6.67%)
Serine (Ser, S)
n = 288 (7.59%)
Threonine (Thr, T)
n = 334 (8.81%)
Cysteine (Cys, C)
n = 20 (0.53%)
Valine (Val, V)
n = 151 (3.98%)
Leucine (Leu, L)
n = 602 (15.87%)
Isoleucine (Ile, I)
n = 335 (8.83%)
Methionine (Met, M)
n = 257 (6.78%)
Proline (Pro, P)
n = 203 (5.35%)
Phenylalanine (Phe, F)
n = 235 (6.2%)
Tyrosine (Tyr, Y)
n = 138 (3.64%)
Tryptophan (Trp, W)
n = 103 (2.72%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 152 (4.01%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
210 125 225 101 71 261 35 119 85 8 47 24 66 14 112 123
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 8 12 58 103 85 7 46 69 72 21 48 74 74 7 79
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 153 12 57 72 100 5 14 40 77 61 5 15 70 82 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 80 11 31 35 78 17 8 16 36 2 0 1 6 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
769 927 1228 870
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
448 1024 742 1580
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
192 1051 1538 1013

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.