Viewing data for Basiliscus vittatus


Scientific name Basiliscus vittatus
Common name Brown basilisk
Maximum lifespan 9.10 years (Basiliscus vittatus@AnAge)

Total mtDNA (size: 16948 bases) GC AT G C A T
Base content (bases) 6903 10045 4623 2280 4383 5662
Base content per 1 kb (bases) 407 593 273 135 259 334
Base content (%) 40.7% 59.3%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4706 6643 3298 1408 2962 3681
Base content per 1 kb (bases) 415 585 291 124 261 324
Base content (%) 41.5% 58.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1537 bases) GC AT G C A T
Base content (bases) 632 905 379 253 385 520
Base content per 1 kb (bases) 411 589 247 165 250 338
Base content (%) 41.1% 58.9%
Total rRNA-coding genes (size: 2453 bases) GC AT G C A T
Base content (bases) 1048 1405 613 435 515 890
Base content per 1 kb (bases) 427 573 250 177 210 363
Base content (%) 42.7% 57.3%
12S rRNA gene (size: 930 bases) GC AT G C A T
Base content (bases) 403 527 231 172 203 324
Base content per 1 kb (bases) 433 567 248 185 218 348
Base content (%) 43.3% 56.7%
16S rRNA gene (size: 1523 bases) GC AT G C A T
Base content (bases) 645 878 382 263 312 566
Base content per 1 kb (bases) 424 576 251 173 205 372
Base content (%) 42.4% 57.6%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 285 398 209 76 191 207
Base content per 1 kb (bases) 417 583 306 111 280 303
Base content (%) 41.7% 58.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 60 108 47 13 41 67
Base content per 1 kb (bases) 357 643 280 77 244 399
Base content (%) 35.7% 64.3%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 660 888 393 267 450 438
Base content per 1 kb (bases) 426 574 254 172 291 283
Base content (%) 42.6% 57.4%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 296 389 204 92 167 222
Base content per 1 kb (bases) 432 568 298 134 244 324
Base content (%) 43.2% 56.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 346 438 220 126 211 227
Base content per 1 kb (bases) 441 559 281 161 269 290
Base content (%) 44.1% 55.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 490 650 338 152 315 335
Base content per 1 kb (bases) 430 570 296 133 276 294
Base content (%) 43.0% 57.0%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 412 554 282 130 252 302
Base content per 1 kb (bases) 427 573 292 135 261 313
Base content (%) 42.7% 57.3%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 421 615 319 102 243 372
Base content per 1 kb (bases) 406 594 308 98 235 359
Base content (%) 40.6% 59.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 143 203 94 49 104 99
Base content per 1 kb (bases) 413 587 272 142 301 286
Base content (%) 41.3% 58.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 552 829 413 139 378 451
Base content per 1 kb (bases) 400 600 299 101 274 327
Base content (%) 40.0% 60.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 93 33 77 94
Base content per 1 kb (bases) 424 576 313 111 259 316
Base content (%) 42.4% 57.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 709 1103 522 187 480 623
Base content per 1 kb (bases) 391 609 288 103 265 344
Base content (%) 39.1% 60.9%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 211 314 167 44 60 254
Base content per 1 kb (bases) 402 598 318 84 114 484
Base content (%) 40.2% 59.8%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 10 (4.42%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 7 (3.1%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 11 14 8 10 20 3 5 10 0 3 6 2 1 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 5 9 0 1 5 2 1 1 5 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 2 1 4 0 0 3 1 2 1 3 1 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 2 0 1 4 0 1 0 3 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 74 80 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 62 33 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 73 93 47
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFLISLMTWITLMLFLNKTLYSKHLNQPAQTSLENKTTTPPWTWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 0 1 3 0 5 3 0 0 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 2 0 0 0 0 0 1 0 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 0 1 0 0 2 0 0 1 0 2 0 0 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 15 21 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 15 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 13 31 8
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.32%)
Alanine (Ala, A)
n = 43 (8.35%)
Serine (Ser, S)
n = 30 (5.83%)
Threonine (Thr, T)
n = 39 (7.57%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 35 (6.8%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 41 (7.96%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 27 (5.24%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 20 (3.88%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 21 26 14 4 24 6 11 9 0 13 9 12 1 21 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 11 10 19 3 5 9 23 11 5 4 16 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 7 7 12 0 1 3 9 11 3 2 5 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 3 4 11 8 0 1 0 7 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 110 137 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 135 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 148 206 126
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 27 (11.89%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 11 3 5 11 3 4 7 0 2 3 7 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 1 7 6 0 0 2 4 2 2 5 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 9 3 0 1 2 2 8 0 1 3 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 0 4 7 2 0 1 0 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 57 68 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 84 95 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 10 3 3 14 4 6 8 0 4 7 7 0 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 10 7 0 0 8 7 5 1 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 1 3 7 0 0 3 2 9 0 0 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 1 3 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 64 60 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 66 55 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 90 112 47
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 12 10 13 27 6 5 8 0 4 5 6 2 11 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 12 11 0 3 3 11 7 3 5 14 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 1 7 8 8 0 0 1 6 8 1 1 3 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 2 2 6 9 1 0 1 6 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 107 109 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 97 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 134 149 71
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.98%)
Alanine (Ala, A)
n = 27 (8.41%)
Serine (Ser, S)
n = 21 (6.54%)
Threonine (Thr, T)
n = 24 (7.48%)
Cysteine (Cys, C)
n = 3 (0.93%)
Valine (Val, V)
n = 16 (4.98%)
Leucine (Leu, L)
n = 54 (16.82%)
Isoleucine (Ile, I)
n = 28 (8.72%)
Methionine (Met, M)
n = 15 (4.67%)
Proline (Pro, P)
n = 23 (7.17%)
Phenylalanine (Phe, F)
n = 21 (6.54%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 9 (2.8%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.74%)
Asparagine (Asn, N)
n = 9 (2.8%)
Glutamine (Gln, Q)
n = 11 (3.43%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 9 (2.8%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 13 7 3 34 5 5 10 1 3 3 8 2 9 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 13 12 0 3 5 4 4 1 5 16 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 2 8 9 0 0 2 3 7 1 0 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 2 0 3 9 0 1 1 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 93 87 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 93 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 96 158 50
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 27 (7.85%)
Serine (Ser, S)
n = 32 (9.3%)
Threonine (Thr, T)
n = 56 (16.28%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 58 (16.86%)
Isoleucine (Ile, I)
n = 34 (9.88%)
Methionine (Met, M)
n = 30 (8.72%)
Proline (Pro, P)
n = 17 (4.94%)
Phenylalanine (Phe, F)
n = 8 (2.33%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.2%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.2%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 25 8 11 28 2 8 8 1 0 2 0 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 12 10 1 3 6 5 0 1 4 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 31 2 3 7 15 1 2 4 1 6 0 1 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 3 9 2 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 84 148 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 126 52 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 109 172 49
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 27 (7.85%)
Serine (Ser, S)
n = 32 (9.3%)
Threonine (Thr, T)
n = 56 (16.28%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 58 (16.86%)
Isoleucine (Ile, I)
n = 34 (9.88%)
Methionine (Met, M)
n = 30 (8.72%)
Proline (Pro, P)
n = 17 (4.94%)
Phenylalanine (Phe, F)
n = 8 (2.33%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.2%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.2%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 25 8 11 28 2 8 8 1 0 2 0 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 12 10 1 3 6 5 0 1 4 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 31 2 3 7 15 1 2 4 1 6 0 1 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 3 9 2 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 84 148 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 126 52 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 109 172 49
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.7%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 50 (10.89%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 12 (2.61%)
Leucine (Leu, L)
n = 92 (20.04%)
Isoleucine (Ile, I)
n = 44 (9.59%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 23 (5.01%)
Phenylalanine (Phe, F)
n = 20 (4.36%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 12 (2.61%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 20 (4.36%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 14 (3.05%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 24 26 18 21 35 3 13 11 1 3 3 6 0 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 6 7 19 1 2 6 7 2 4 4 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 25 1 3 10 11 0 3 4 3 9 0 2 5 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 0 2 11 2 1 1 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 137 164 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 130 80 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 146 207 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 12 (12.24%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 3 3 11 1 4 1 0 2 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 5 2 0 0 3 1 1 0 0 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 0 1 1 4 0 0 2 0 1 0 0 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 0 1 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 30 33 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 29 18 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 34 43 18
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.31%)
Alanine (Ala, A)
n = 46 (7.63%)
Serine (Ser, S)
n = 41 (6.8%)
Threonine (Thr, T)
n = 77 (12.77%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 13 (2.16%)
Leucine (Leu, L)
n = 84 (13.93%)
Isoleucine (Ile, I)
n = 70 (11.61%)
Methionine (Met, M)
n = 30 (4.98%)
Proline (Pro, P)
n = 25 (4.15%)
Phenylalanine (Phe, F)
n = 39 (6.47%)
Tyrosine (Tyr, Y)
n = 14 (2.32%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 38 (6.3%)
Glutamine (Gln, Q)
n = 22 (3.65%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 22 (3.65%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
40 30 27 13 15 40 3 12 20 2 2 3 7 1 22 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 4 6 20 19 1 3 7 12 4 2 5 17 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 32 2 10 7 13 0 3 8 2 12 1 1 7 31 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 1 8 21 1 0 1 8 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 139 248 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 178 128 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 205 247 131
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.24%)
Alanine (Ala, A)
n = 6 (3.45%)
Serine (Ser, S)
n = 15 (8.62%)
Threonine (Thr, T)
n = 5 (2.87%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 27 (15.52%)
Leucine (Leu, L)
n = 35 (20.11%)
Isoleucine (Ile, I)
n = 4 (2.3%)
Methionine (Met, M)
n = 2 (1.15%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 8 (4.6%)
Tryptophan (Trp, W)
n = 4 (2.3%)
Aspartic acid (Asp, D)
n = 5 (2.87%)
Glutamic acid (Glu, E)
n = 2 (1.15%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.15%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 3 0 0 0 14 0 0 18 0 1 8 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 4 0 4 0 1 1 12 0 6 12 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 9 0 0 3 3 0 6 2 3 18 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 2 5 0 0 0 3 0 0 1 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 13 16 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 27 18 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 4 26 94
Total protein-coding genes (size: 11371 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.86%)
Alanine (Ala, A)
n = 275 (7.26%)
Serine (Ser, S)
n = 253 (6.68%)
Threonine (Thr, T)
n = 375 (9.9%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 167 (4.41%)
Leucine (Leu, L)
n = 612 (16.16%)
Isoleucine (Ile, I)
n = 334 (8.82%)
Methionine (Met, M)
n = 208 (5.49%)
Proline (Pro, P)
n = 201 (5.31%)
Phenylalanine (Phe, F)
n = 226 (5.97%)
Tyrosine (Tyr, Y)
n = 115 (3.04%)
Tryptophan (Trp, W)
n = 104 (2.75%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 89 (2.35%)
Asparagine (Asn, N)
n = 145 (3.83%)
Glutamine (Gln, Q)
n = 102 (2.69%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
163 171 174 94 95 257 37 100 96 6 54 41 56 16 116 110
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 14 17 42 105 121 7 33 56 84 49 24 42 126 9 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
127 177 9 48 61 91 4 15 34 38 77 11 29 39 106 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 76 13 20 46 80 6 10 4 53 4 1 1 5 0 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 956 1199 814
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
479 1055 707 1547
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
235 1167 1590 796

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.