Viewing data for Carcharias taurus


Scientific name Carcharias taurus
Common name Sand tiger shark
Maximum lifespan 12.00 years (Carcharias taurus@AnAge)

Total mtDNA (size: 16773 bases) GC AT G C A T
Base content (bases) 6627 10146 4415 2212 4820 5326
Base content per 1 kb (bases) 395 605 263 132 287 318
Base content (%) 39.5% 60.5%
Total protein-coding genes (size: 11402 bases) GC AT G C A T
Base content (bases) 4582 6820 3240 1342 3348 3472
Base content per 1 kb (bases) 402 598 284 118 294 305
Base content (%) 40.2% 59.8%
D-loop (size: 1059 bases) GC AT G C A T
Base content (bases) 371 688 227 144 344 344
Base content per 1 kb (bases) 350 650 214 136 325 325
Base content (%) 35.0% 65.0%
Total tRNA-coding genes (size: 1548 bases) GC AT G C A T
Base content (bases) 596 952 346 250 423 529
Base content per 1 kb (bases) 385 615 224 161 273 342
Base content (%) 38.5% 61.5%
Total rRNA-coding genes (size: 2624 bases) GC AT G C A T
Base content (bases) 1020 1604 568 452 666 938
Base content per 1 kb (bases) 389 611 216 172 254 357
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 393 560 222 171 226 334
Base content per 1 kb (bases) 412 588 233 179 237 350
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1671 bases) GC AT G C A T
Base content (bases) 627 1044 346 281 440 604
Base content per 1 kb (bases) 375 625 207 168 263 361
Base content (%) 37.5% 62.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 250 434 183 67 220 214
Base content per 1 kb (bases) 365 635 268 98 322 313
Base content (%) 36.5% 63.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 55 113 43 12 47 66
Base content per 1 kb (bases) 327 673 256 71 280 393
Base content (%) 32.7% 67.3%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 617 937 369 248 503 434
Base content per 1 kb (bases) 397 603 237 160 324 279
Base content (%) 39.7% 60.3%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 259 432 164 95 209 223
Base content per 1 kb (bases) 375 625 237 137 302 323
Base content (%) 37.5% 62.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 321 465 203 118 238 227
Base content per 1 kb (bases) 408 592 258 150 303 289
Base content (%) 40.8% 59.2%
CYTB (size: 1145 bases) GC AT G C A T
Base content (bases) 478 667 341 137 348 319
Base content per 1 kb (bases) 417 583 298 120 304 279
Base content (%) 41.7% 58.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 420 555 303 117 274 281
Base content per 1 kb (bases) 431 569 311 120 281 288
Base content (%) 43.1% 56.9%
ND2 (size: 1043 bases) GC AT G C A T
Base content (bases) 416 627 321 95 305 322
Base content per 1 kb (bases) 399 601 308 91 292 309
Base content (%) 39.9% 60.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 153 196 104 49 110 86
Base content per 1 kb (bases) 438 562 298 140 315 246
Base content (%) 43.8% 56.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 536 845 386 150 408 437
Base content per 1 kb (bases) 388 612 280 109 295 316
Base content (%) 38.8% 61.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 120 177 91 29 93 84
Base content per 1 kb (bases) 404 596 306 98 313 283
Base content (%) 40.4% 59.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 751 1079 566 185 510 569
Base content per 1 kb (bases) 410 590 309 101 279 311
Base content (%) 41.0% 59.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 212 310 170 42 89 221
Base content per 1 kb (bases) 406 594 326 80 170 423
Base content (%) 40.6% 59.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 52 (22.91%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 15 (6.61%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 7 9 9 7 20 2 14 7 0 2 1 5 0 9 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 1 10 0 1 2 3 2 3 5 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 0 2 1 0 2 3 2 2 0 0 7 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 2 0 0 0 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 70 79 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 34 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 53 101 67
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPHPWFTILLFSWMIFLVILPKKVMNHMFNNNPMLKNTEKPKPEPWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 3 1 1 1 0 3 1 0 1 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 3 3 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 0 0 2 0 0 0 0 0 0 0 3 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 15 22 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 13 18 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 15 26 12
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 33 (6.38%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 66 (12.77%)
Isoleucine (Ile, I)
n = 43 (8.32%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 40 (7.74%)
Tyrosine (Tyr, Y)
n = 18 (3.48%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 17 23 19 9 14 0 22 7 2 11 3 21 4 25 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 10 16 19 0 16 9 20 1 7 7 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 3 10 5 12 0 1 2 11 7 2 2 5 10 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 4 10 8 0 1 0 8 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
155 108 127 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 127 212 162
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 13 (5.68%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 15 (6.55%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 14 (6.11%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 12 6 2 8 0 9 9 0 5 4 7 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 4 4 0 4 3 2 0 4 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 1 4 3 6 0 2 1 10 0 0 1 2 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 1 6 6 5 0 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 54 63 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 56 95 74
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.36%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 18 (6.9%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 5 6 6 8 1 12 8 0 4 2 8 0 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 6 10 6 0 5 5 11 0 2 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 2 2 6 0 1 2 9 3 0 0 0 3 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 2 3 2 0 1 1 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 63 55 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 73 115 71
CYTB (size: 1145 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 22 (5.79%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 22 (5.79%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 60 (15.79%)
Isoleucine (Ile, I)
n = 45 (11.84%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 21 (5.53%)
Phenylalanine (Phe, F)
n = 35 (9.21%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 22 (5.79%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 24 8 5 21 26 1 6 8 1 4 4 8 1 14 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 7 11 4 0 2 7 14 2 6 7 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 8 7 5 0 0 2 6 7 0 1 8 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 3 6 9 0 1 3 4 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 102 109 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 85 79 166
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 154 130 90
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 26 (8.02%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 25 (7.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (3.09%)
Leucine (Leu, L)
n = 69 (21.3%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 14 4 19 30 4 12 5 0 1 3 6 0 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 11 10 1 3 8 5 2 4 13 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 4 7 8 1 1 2 4 9 0 0 7 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 2 2 1 7 0 2 1 4 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 95 89 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 93 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 115 135 63
ND2 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 73 (21.1%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 14 (4.05%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 12 15 14 23 0 21 9 1 1 3 3 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 8 11 5 0 3 7 6 0 5 4 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 5 12 12 0 1 4 3 4 1 0 2 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 0 9 1 1 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 93 120 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 111 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 117 144 80
ND3 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 73 (21.1%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 14 (4.05%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 12 15 14 23 0 21 9 1 1 3 3 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 8 11 5 0 3 7 6 0 5 4 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 5 12 12 0 1 4 3 4 1 0 2 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 0 9 1 1 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 93 120 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 111 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 117 144 80
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 38 (8.28%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 89 (19.39%)
Isoleucine (Ile, I)
n = 49 (10.68%)
Methionine (Met, M)
n = 28 (6.1%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 19 (4.14%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.14%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 22 26 22 19 30 0 18 12 0 2 2 7 0 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 13 9 9 2 5 5 11 0 4 8 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 0 4 8 9 0 3 6 5 6 0 0 6 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 0 3 2 11 0 0 2 8 1 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 133 154 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 118 81 196
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 135 202 118
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 4 4 5 11 0 3 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 2 3 2 0 2 2 0 0 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 2 4 4 0 2 0 1 0 0 0 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 29 31 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 33 37 28
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 36 (5.91%)
Serine (Ser, S)
n = 51 (8.37%)
Threonine (Thr, T)
n = 56 (9.2%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 15 (2.46%)
Leucine (Leu, L)
n = 111 (18.23%)
Isoleucine (Ile, I)
n = 58 (9.52%)
Methionine (Met, M)
n = 27 (4.43%)
Proline (Pro, P)
n = 29 (4.76%)
Phenylalanine (Phe, F)
n = 40 (6.57%)
Tyrosine (Tyr, Y)
n = 12 (1.97%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 22 (3.61%)
Histidine (His, H)
n = 15 (2.46%)
Lysine (Lys, K)
n = 23 (3.78%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 30 21 19 32 42 3 13 21 1 3 5 7 0 14 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 13 17 6 0 6 8 13 1 4 12 13 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 20 0 4 13 22 0 3 9 3 9 2 2 11 24 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 0 7 6 23 0 1 5 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 172 211 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 160 131 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 234 227 134
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 12 (6.94%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 27 (15.61%)
Leucine (Leu, L)
n = 34 (19.65%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 3 0 0 3 0 15 0 0 10 0 8 9 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 8 0 2 2 8 1 4 11 3 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 0 1 1 2 1 10 0 4 16 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 1 0 1 0 2 0 0 1 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 11 23 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 27 24 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 4 42 70
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.94%)
Alanine (Ala, A)
n = 266 (6.99%)
Serine (Ser, S)
n = 260 (6.83%)
Threonine (Thr, T)
n = 295 (7.75%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 169 (4.44%)
Leucine (Leu, L)
n = 671 (17.63%)
Isoleucine (Ile, I)
n = 346 (9.09%)
Methionine (Met, M)
n = 172 (4.52%)
Proline (Pro, P)
n = 210 (5.52%)
Phenylalanine (Phe, F)
n = 240 (6.31%)
Tyrosine (Tyr, Y)
n = 113 (2.97%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 102 (2.68%)
Asparagine (Asn, N)
n = 156 (4.1%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 107 (2.81%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
187 159 140 113 144 225 14 153 91 5 44 27 84 14 115 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 13 12 83 95 83 5 56 60 90 20 45 71 93 1 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
101 126 7 51 65 91 2 18 33 65 48 9 22 58 98 44
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 92 10 30 37 83 1 10 17 42 3 0 1 7 0 112
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
830 981 1105 890
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 980 732 1598
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
146 1155 1512 993

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.