Viewing data for Homarus americanus


Scientific name Homarus americanus
Common name American lobster
Maximum lifespan 100.00 years (Homarus americanus@AnAge)

Total mtDNA (size: 16432 bases) GC AT G C A T
Base content (bases) 5007 11425 3015 1992 5770 5655
Base content per 1 kb (bases) 305 695 183 121 351 344
Base content (%) 30.5% 69.5%
Total protein-coding genes (size: 11149 bases) GC AT G C A T
Base content (bases) 3590 7559 2157 1433 3835 3724
Base content per 1 kb (bases) 322 678 193 129 344 334
Base content (%) 32.2% 67.8%
D-loop (size: 1488 bases) GC AT G C A T
Base content (bases) 387 1101 226 161 521 580
Base content per 1 kb (bases) 260 740 152 108 350 390
Base content (%) 26.0% 74.0%
Total tRNA-coding genes (size: 1464 bases) GC AT G C A T
Base content (bases) 432 1032 238 194 512 520
Base content per 1 kb (bases) 295 705 163 133 350 355
Base content (%) 29.5% 70.5%
Total rRNA-coding genes (size: 2183 bases) GC AT G C A T
Base content (bases) 570 1613 379 191 839 774
Base content per 1 kb (bases) 261 739 174 87 384 355
Base content (%) 26.1% 73.9%
12S rRNA gene (size: 843 bases) GC AT G C A T
Base content (bases) 217 626 141 76 333 293
Base content per 1 kb (bases) 257 743 167 90 395 348
Base content (%) 25.7% 74.3%
16S rRNA gene (size: 1340 bases) GC AT G C A T
Base content (bases) 353 987 238 115 506 481
Base content per 1 kb (bases) 263 737 178 86 378 359
Base content (%) 26.3% 73.7%

ATP6 (size: 674 bases) GC AT G C A T
Base content (bases) 227 447 132 95 258 189
Base content per 1 kb (bases) 337 663 196 141 383 280
Base content (%) 33.7% 66.3%
ATP8 (size: 159 bases) GC AT G C A T
Base content (bases) 39 120 29 10 64 56
Base content per 1 kb (bases) 245 755 182 63 403 352
Base content (%) 24.5% 75.5%
COX1 (size: 1537 bases) GC AT G C A T
Base content (bases) 561 976 309 252 542 434
Base content per 1 kb (bases) 365 635 201 164 353 282
Base content (%) 36.5% 63.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 247 441 138 109 241 200
Base content per 1 kb (bases) 359 641 201 158 350 291
Base content (%) 35.9% 64.1%
COX3 (size: 792 bases) GC AT G C A T
Base content (bases) 277 515 149 128 298 217
Base content per 1 kb (bases) 350 650 188 162 376 274
Base content (%) 35.0% 65.0%
CYTB (size: 1135 bases) GC AT G C A T
Base content (bases) 381 754 216 165 455 299
Base content per 1 kb (bases) 336 664 190 145 401 263
Base content (%) 33.6% 66.4%
ND1 (size: 939 bases) GC AT G C A T
Base content (bases) 299 640 188 111 234 406
Base content per 1 kb (bases) 318 682 200 118 249 432
Base content (%) 31.8% 68.2%
ND2 (size: 1000 bases) GC AT G C A T
Base content (bases) 305 695 206 99 427 268
Base content per 1 kb (bases) 305 695 206 99 427 268
Base content (%) 30.5% 69.5%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 106 246 60 46 154 92
Base content per 1 kb (bases) 301 699 170 131 438 261
Base content (%) 30.1% 69.9%
ND4 (size: 1340 bases) GC AT G C A T
Base content (bases) 404 936 265 139 353 583
Base content per 1 kb (bases) 301 699 198 104 263 435
Base content (%) 30.1% 69.9%
ND4L (size: 303 bases) GC AT G C A T
Base content (bases) 87 216 52 35 77 139
Base content per 1 kb (bases) 287 713 172 116 254 459
Base content (%) 28.7% 71.3%
ND5 (size: 1726 bases) GC AT G C A T
Base content (bases) 514 1212 317 197 498 714
Base content per 1 kb (bases) 298 702 184 114 289 414
Base content (%) 29.8% 70.2%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 145 374 97 48 239 135
Base content per 1 kb (bases) 279 721 187 92 461 260
Base content (%) 27.9% 72.1%

ATP6 (size: 674 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.93%)
Alanine (Ala, A)
n = 17 (7.62%)
Serine (Ser, S)
n = 24 (10.76%)
Threonine (Thr, T)
n = 16 (7.17%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.38%)
Leucine (Leu, L)
n = 45 (20.18%)
Isoleucine (Ile, I)
n = 16 (7.17%)
Methionine (Met, M)
n = 14 (6.28%)
Proline (Pro, P)
n = 10 (4.48%)
Phenylalanine (Phe, F)
n = 16 (7.17%)
Tyrosine (Tyr, Y)
n = 5 (2.24%)
Tryptophan (Trp, W)
n = 6 (2.69%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (2.24%)
Asparagine (Asn, N)
n = 9 (4.04%)
Glutamine (Gln, Q)
n = 7 (3.14%)
Histidine (His, H)
n = 6 (2.69%)
Lysine (Lys, K)
n = 2 (0.9%)
Arginine (Arg, R)
n = 3 (1.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 3 10 13 2 5 2 19 7 0 7 0 2 3 14 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 3 7 1 2 2 4 3 3 3 4 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 6 1 7 2 0 0 4 1 1 4 5 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 0 2 0 1 0 2 0 7 1 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 48 65 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 59 34 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 25 89 88
ATP8 (size: 159 bases)
Amino acid sequence: MPQMAPLLWLNLFFMFLIGFLLFFILNYFMKSPLKMSPSIELKAQHQKTWKW*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.92%)
Alanine (Ala, A)
n = 2 (3.85%)
Serine (Ser, S)
n = 3 (5.77%)
Threonine (Thr, T)
n = 1 (1.92%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (19.23%)
Isoleucine (Ile, I)
n = 3 (5.77%)
Methionine (Met, M)
n = 5 (9.62%)
Proline (Pro, P)
n = 4 (7.69%)
Phenylalanine (Phe, F)
n = 7 (13.46%)
Tyrosine (Tyr, Y)
n = 1 (1.92%)
Tryptophan (Trp, W)
n = 3 (5.77%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.92%)
Asparagine (Asn, N)
n = 2 (3.85%)
Glutamine (Gln, Q)
n = 3 (5.77%)
Histidine (His, H)
n = 1 (1.92%)
Lysine (Lys, K)
n = 5 (9.62%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 4 0 3 0 3 3 0 0 0 0 0 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 1 0 3 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 1 1 1 0 0 0 1 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 0 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 15 16 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 10 14 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 4 26 21
COX1 (size: 1537 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.2%)
Alanine (Ala, A)
n = 39 (7.63%)
Serine (Ser, S)
n = 37 (7.24%)
Threonine (Thr, T)
n = 36 (7.05%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 41 (8.02%)
Leucine (Leu, L)
n = 57 (11.15%)
Isoleucine (Ile, I)
n = 43 (8.41%)
Methionine (Met, M)
n = 31 (6.07%)
Proline (Pro, P)
n = 25 (4.89%)
Phenylalanine (Phe, F)
n = 42 (8.22%)
Tyrosine (Tyr, Y)
n = 15 (2.94%)
Tryptophan (Trp, W)
n = 15 (2.94%)
Aspartic acid (Asp, D)
n = 16 (3.13%)
Glutamic acid (Glu, E)
n = 8 (1.57%)
Asparagine (Asn, N)
n = 16 (3.13%)
Glutamine (Gln, Q)
n = 9 (1.76%)
Histidine (His, H)
n = 17 (3.33%)
Lysine (Lys, K)
n = 8 (1.57%)
Arginine (Arg, R)
n = 10 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 10 27 19 7 7 2 21 8 1 21 2 17 1 27 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 18 4 17 0 13 6 25 3 11 4 10 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 2 10 3 11 3 3 1 8 7 1 1 13 3 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 6 10 8 0 2 0 8 0 6 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 96 144 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
82 127 89 214
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 86 201 206
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.39%)
Alanine (Ala, A)
n = 14 (6.14%)
Serine (Ser, S)
n = 20 (8.77%)
Threonine (Thr, T)
n = 13 (5.7%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 19 (8.33%)
Leucine (Leu, L)
n = 28 (12.28%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 11 (4.82%)
Proline (Pro, P)
n = 11 (4.82%)
Phenylalanine (Phe, F)
n = 16 (7.02%)
Tyrosine (Tyr, Y)
n = 6 (2.63%)
Tryptophan (Trp, W)
n = 6 (2.63%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 9 (3.95%)
Asparagine (Asn, N)
n = 12 (5.26%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 7 (3.07%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 3 7 11 2 4 2 8 8 0 7 3 8 1 13 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 7 1 5 1 2 1 6 1 5 1 4 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 0 3 4 7 0 2 0 5 1 0 1 4 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 2 6 5 2 0 2 0 4 1 3 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 51 62 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 52 54 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 35 84 95
COX3 (size: 792 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.84%)
Alanine (Ala, A)
n = 19 (7.22%)
Serine (Ser, S)
n = 25 (9.51%)
Threonine (Thr, T)
n = 19 (7.22%)
Cysteine (Cys, C)
n = 3 (1.14%)
Valine (Val, V)
n = 17 (6.46%)
Leucine (Leu, L)
n = 29 (11.03%)
Isoleucine (Ile, I)
n = 17 (6.46%)
Methionine (Met, M)
n = 9 (3.42%)
Proline (Pro, P)
n = 8 (3.04%)
Phenylalanine (Phe, F)
n = 28 (10.65%)
Tyrosine (Tyr, Y)
n = 10 (3.8%)
Tryptophan (Trp, W)
n = 13 (4.94%)
Aspartic acid (Asp, D)
n = 6 (2.28%)
Glutamic acid (Glu, E)
n = 7 (2.66%)
Asparagine (Asn, N)
n = 4 (1.52%)
Glutamine (Gln, Q)
n = 8 (3.04%)
Histidine (His, H)
n = 16 (6.08%)
Lysine (Lys, K)
n = 3 (1.14%)
Arginine (Arg, R)
n = 4 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 3 8 10 2 2 1 11 7 1 9 0 8 0 21 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 0 11 2 6 0 4 0 9 5 3 1 3 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 0 5 1 12 0 1 0 6 4 4 3 4 0 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 4 2 3 0 2 0 2 0 6 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 51 59 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 64 55 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 34 103 111
CYTB (size: 1135 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.37%)
Alanine (Ala, A)
n = 30 (7.96%)
Serine (Ser, S)
n = 17 (4.51%)
Threonine (Thr, T)
n = 25 (6.63%)
Cysteine (Cys, C)
n = 3 (0.8%)
Valine (Val, V)
n = 28 (7.43%)
Leucine (Leu, L)
n = 56 (14.85%)
Isoleucine (Ile, I)
n = 36 (9.55%)
Methionine (Met, M)
n = 12 (3.18%)
Proline (Pro, P)
n = 22 (5.84%)
Phenylalanine (Phe, F)
n = 33 (8.75%)
Tyrosine (Tyr, Y)
n = 16 (4.24%)
Tryptophan (Trp, W)
n = 11 (2.92%)
Aspartic acid (Asp, D)
n = 11 (2.92%)
Glutamic acid (Glu, E)
n = 3 (0.8%)
Asparagine (Asn, N)
n = 15 (3.98%)
Glutamine (Gln, Q)
n = 7 (1.86%)
Histidine (His, H)
n = 14 (3.71%)
Lysine (Lys, K)
n = 7 (1.86%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 5 10 18 2 7 2 23 7 0 17 3 6 2 25 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 16 1 12 1 7 2 13 2 12 2 7 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 1 5 2 5 0 1 1 9 7 2 4 9 6 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 9 2 7 0 2 1 5 0 3 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 80 100 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 89 73 165
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 47 126 187
ND1 (size: 939 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (7.69%)
Alanine (Ala, A)
n = 23 (7.37%)
Serine (Ser, S)
n = 27 (8.65%)
Threonine (Thr, T)
n = 11 (3.53%)
Cysteine (Cys, C)
n = 7 (2.24%)
Valine (Val, V)
n = 25 (8.01%)
Leucine (Leu, L)
n = 52 (16.67%)
Isoleucine (Ile, I)
n = 19 (6.09%)
Methionine (Met, M)
n = 13 (4.17%)
Proline (Pro, P)
n = 12 (3.85%)
Phenylalanine (Phe, F)
n = 30 (9.62%)
Tyrosine (Tyr, Y)
n = 15 (4.81%)
Tryptophan (Trp, W)
n = 7 (2.24%)
Aspartic acid (Asp, D)
n = 3 (0.96%)
Glutamic acid (Glu, E)
n = 12 (3.85%)
Asparagine (Asn, N)
n = 9 (2.88%)
Glutamine (Gln, Q)
n = 5 (1.6%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 11 (3.53%)
Arginine (Arg, R)
n = 7 (2.24%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 0 10 11 0 2 2 28 3 2 11 1 8 5 27 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 7 0 15 0 5 3 11 1 10 2 6 2 3 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 11 0 2 0 5 1 12 3 4 9 8 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 5 3 0 9 2 4 0 2 1 7 1 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 39 77 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 59 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 13 101 157
ND2 (size: 1000 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.92%)
Alanine (Ala, A)
n = 23 (6.93%)
Serine (Ser, S)
n = 44 (13.25%)
Threonine (Thr, T)
n = 15 (4.52%)
Cysteine (Cys, C)
n = 1 (0.3%)
Valine (Val, V)
n = 9 (2.71%)
Leucine (Leu, L)
n = 58 (17.47%)
Isoleucine (Ile, I)
n = 39 (11.75%)
Methionine (Met, M)
n = 18 (5.42%)
Proline (Pro, P)
n = 17 (5.12%)
Phenylalanine (Phe, F)
n = 31 (9.34%)
Tyrosine (Tyr, Y)
n = 11 (3.31%)
Tryptophan (Trp, W)
n = 8 (2.41%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.51%)
Asparagine (Asn, N)
n = 12 (3.61%)
Glutamine (Gln, Q)
n = 12 (3.61%)
Histidine (His, H)
n = 5 (1.51%)
Lysine (Lys, K)
n = 9 (2.71%)
Arginine (Arg, R)
n = 3 (0.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 7 16 22 3 6 2 19 10 2 5 2 1 1 23 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 8 2 13 0 4 1 7 1 8 2 5 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 22 6 10 1 3 0 7 4 1 6 10 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 0 9 0 0 0 3 0 2 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 70 98 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 94 54 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 42 116 156
ND3 (size: 1000 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.92%)
Alanine (Ala, A)
n = 23 (6.93%)
Serine (Ser, S)
n = 44 (13.25%)
Threonine (Thr, T)
n = 15 (4.52%)
Cysteine (Cys, C)
n = 1 (0.3%)
Valine (Val, V)
n = 9 (2.71%)
Leucine (Leu, L)
n = 58 (17.47%)
Isoleucine (Ile, I)
n = 39 (11.75%)
Methionine (Met, M)
n = 18 (5.42%)
Proline (Pro, P)
n = 17 (5.12%)
Phenylalanine (Phe, F)
n = 31 (9.34%)
Tyrosine (Tyr, Y)
n = 11 (3.31%)
Tryptophan (Trp, W)
n = 8 (2.41%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.51%)
Asparagine (Asn, N)
n = 12 (3.61%)
Glutamine (Gln, Q)
n = 12 (3.61%)
Histidine (His, H)
n = 5 (1.51%)
Lysine (Lys, K)
n = 9 (2.71%)
Arginine (Arg, R)
n = 3 (0.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 7 16 22 3 6 2 19 10 2 5 2 1 1 23 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 8 2 13 0 4 1 7 1 8 2 5 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 22 6 10 1 3 0 7 4 1 6 10 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 0 9 0 0 0 3 0 2 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 70 98 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 94 54 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 42 116 156
ND4 (size: 1340 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 36 (8.09%)
Alanine (Ala, A)
n = 22 (4.94%)
Serine (Ser, S)
n = 51 (11.46%)
Threonine (Thr, T)
n = 12 (2.7%)
Cysteine (Cys, C)
n = 10 (2.25%)
Valine (Val, V)
n = 36 (8.09%)
Leucine (Leu, L)
n = 83 (18.65%)
Isoleucine (Ile, I)
n = 32 (7.19%)
Methionine (Met, M)
n = 24 (5.39%)
Proline (Pro, P)
n = 14 (3.15%)
Phenylalanine (Phe, F)
n = 38 (8.54%)
Tyrosine (Tyr, Y)
n = 15 (3.37%)
Tryptophan (Trp, W)
n = 14 (3.15%)
Aspartic acid (Asp, D)
n = 4 (0.9%)
Glutamic acid (Glu, E)
n = 9 (2.02%)
Asparagine (Asn, N)
n = 13 (2.92%)
Glutamine (Gln, Q)
n = 7 (1.57%)
Histidine (His, H)
n = 8 (1.8%)
Lysine (Lys, K)
n = 13 (2.92%)
Arginine (Arg, R)
n = 5 (1.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 0 16 9 1 7 1 42 5 2 16 0 17 3 37 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 8 2 13 2 5 2 16 2 12 6 11 0 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 2 16 0 4 3 6 1 10 5 6 23 12 1 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 6 3 3 1 9 4 3 0 2 0 19 2 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 52 122 165
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
93 71 69 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 16 161 204
ND4L (size: 303 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.0%)
Alanine (Ala, A)
n = 5 (5.0%)
Serine (Ser, S)
n = 10 (10.0%)
Threonine (Thr, T)
n = 4 (4.0%)
Cysteine (Cys, C)
n = 5 (5.0%)
Valine (Val, V)
n = 9 (9.0%)
Leucine (Leu, L)
n = 18 (18.0%)
Isoleucine (Ile, I)
n = 9 (9.0%)
Methionine (Met, M)
n = 5 (5.0%)
Proline (Pro, P)
n = 1 (1.0%)
Phenylalanine (Phe, F)
n = 11 (11.0%)
Tyrosine (Tyr, Y)
n = 1 (1.0%)
Tryptophan (Trp, W)
n = 2 (2.0%)
Aspartic acid (Asp, D)
n = 1 (1.0%)
Glutamic acid (Glu, E)
n = 3 (3.0%)
Asparagine (Asn, N)
n = 3 (3.0%)
Glutamine (Gln, Q)
n = 1 (1.0%)
Histidine (His, H)
n = 2 (2.0%)
Lysine (Lys, K)
n = 2 (2.0%)
Arginine (Arg, R)
n = 2 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 4 5 0 2 0 9 1 0 4 2 2 1 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 5 0 4 0 1 0 3 1 1 1 1 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 0 1 0 2 0 1 0 0 2 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 1 0 2 0 0 0 1 1 4 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 13 29 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 14 14 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 8 34 52
ND5 (size: 1726 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 37 (6.45%)
Alanine (Ala, A)
n = 44 (7.67%)
Serine (Ser, S)
n = 74 (12.89%)
Threonine (Thr, T)
n = 24 (4.18%)
Cysteine (Cys, C)
n = 11 (1.92%)
Valine (Val, V)
n = 48 (8.36%)
Leucine (Leu, L)
n = 89 (15.51%)
Isoleucine (Ile, I)
n = 35 (6.1%)
Methionine (Met, M)
n = 41 (7.14%)
Proline (Pro, P)
n = 10 (1.74%)
Phenylalanine (Phe, F)
n = 43 (7.49%)
Tyrosine (Tyr, Y)
n = 26 (4.53%)
Tryptophan (Trp, W)
n = 10 (1.74%)
Aspartic acid (Asp, D)
n = 12 (2.09%)
Glutamic acid (Glu, E)
n = 10 (1.74%)
Asparagine (Asn, N)
n = 21 (3.66%)
Glutamine (Gln, Q)
n = 10 (1.74%)
Histidine (His, H)
n = 8 (1.39%)
Lysine (Lys, K)
n = 16 (2.79%)
Arginine (Arg, R)
n = 6 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 3 35 10 1 6 1 55 10 0 24 3 13 8 36 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 10 1 28 2 13 1 17 1 14 5 4 1 5 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 8 3 22 1 8 0 12 1 20 6 4 16 17 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 8 2 8 4 13 3 4 1 1 0 20 10 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 52 180 192
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
107 109 103 256
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 36 215 265
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (1.16%)
Alanine (Ala, A)
n = 9 (5.23%)
Serine (Ser, S)
n = 24 (13.95%)
Threonine (Thr, T)
n = 13 (7.56%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 10 (5.81%)
Leucine (Leu, L)
n = 34 (19.77%)
Isoleucine (Ile, I)
n = 19 (11.05%)
Methionine (Met, M)
n = 10 (5.81%)
Proline (Pro, P)
n = 8 (4.65%)
Phenylalanine (Phe, F)
n = 17 (9.88%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 1 (0.58%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 1 (0.58%)
Asparagine (Asn, N)
n = 5 (2.91%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 3 (1.74%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 2 8 14 2 6 0 9 1 0 6 0 3 1 15 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 1 2 2 0 0 0 2 5 0 3 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 8 1 9 1 0 0 5 2 0 3 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 3 1 3 0 1 0 1 0 5 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 34 55 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 49 23 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 14 57 91
Total protein-coding genes (size: 11164 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 234 (6.3%)
Alanine (Ala, A)
n = 253 (6.81%)
Serine (Ser, S)
n = 367 (9.87%)
Threonine (Thr, T)
n = 195 (5.25%)
Cysteine (Cys, C)
n = 44 (1.18%)
Valine (Val, V)
n = 262 (7.05%)
Leucine (Leu, L)
n = 579 (15.58%)
Isoleucine (Ile, I)
n = 300 (8.07%)
Methionine (Met, M)
n = 196 (5.27%)
Proline (Pro, P)
n = 146 (3.93%)
Phenylalanine (Phe, F)
n = 325 (8.74%)
Tyrosine (Tyr, Y)
n = 131 (3.52%)
Tryptophan (Trp, W)
n = 99 (2.66%)
Aspartic acid (Asp, D)
n = 71 (1.91%)
Glutamic acid (Glu, E)
n = 78 (2.1%)
Asparagine (Asn, N)
n = 123 (3.31%)
Glutamine (Gln, Q)
n = 79 (2.13%)
Histidine (His, H)
n = 86 (2.31%)
Lysine (Lys, K)
n = 85 (2.29%)
Arginine (Arg, R)
n = 60 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
261 39 157 155 22 57 16 255 71 8 131 16 89 26 266 59
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 39 5 132 22 88 11 79 19 104 32 74 17 49 6 97
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 70 10 116 21 81 11 35 5 90 41 23 74 87 36 59
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
27 61 17 46 25 76 9 21 2 34 3 83 15 4 1 76
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
898 621 1037 1162
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
575 823 658 1662
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
301 374 1355 1688

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.