Viewing data for Botaurus stellaris


Scientific name Botaurus stellaris
Common name Bittern
Maximum lifespan 11.30 years (Botaurus stellaris@AnAge)

Total mtDNA (size: 20350 bases) GC AT G C A T
Base content (bases) 8671 11679 6112 2559 5170 6509
Base content per 1 kb (bases) 426 574 300 126 254 320
Base content (%) 42.6% 57.4%
Total protein-coding genes (size: 11901 bases) GC AT G C A T
Base content (bases) 5435 6466 4080 1355 2751 3715
Base content per 1 kb (bases) 457 543 343 114 231 312
Base content (%) 45.7% 54.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1765 bases) GC AT G C A T
Base content (bases) 753 1012 462 291 438 574
Base content per 1 kb (bases) 427 573 262 165 248 325
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2579 bases) GC AT G C A T
Base content (bases) 1157 1422 674 483 564 858
Base content per 1 kb (bases) 449 551 261 187 219 333
Base content (%) 44.9% 55.1%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 458 518 266 192 204 314
Base content per 1 kb (bases) 469 531 273 197 209 322
Base content (%) 46.9% 53.1%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 699 904 408 291 360 544
Base content per 1 kb (bases) 436 564 255 182 225 339
Base content (%) 43.6% 56.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 300 384 239 61 170 214
Base content per 1 kb (bases) 439 561 349 89 249 313
Base content (%) 43.9% 56.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 66 102 58 8 41 61
Base content per 1 kb (bases) 393 607 345 48 244 363
Base content (%) 39.3% 60.7%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 719 832 480 239 394 438
Base content per 1 kb (bases) 464 536 309 154 254 282
Base content (%) 46.4% 53.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 317 367 224 93 156 211
Base content per 1 kb (bases) 463 537 327 136 228 308
Base content (%) 46.3% 53.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 365 419 256 109 180 239
Base content per 1 kb (bases) 466 534 327 139 230 305
Base content (%) 46.6% 53.4%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 541 602 405 136 278 324
Base content per 1 kb (bases) 473 527 354 119 243 283
Base content (%) 47.3% 52.7%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 448 530 330 118 261 269
Base content per 1 kb (bases) 458 542 337 121 267 275
Base content (%) 45.8% 54.2%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 458 583 365 93 238 345
Base content per 1 kb (bases) 440 560 351 89 229 331
Base content (%) 44.0% 56.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 167 185 126 41 94 91
Base content per 1 kb (bases) 474 526 358 116 267 259
Base content (%) 47.4% 52.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 619 759 486 133 338 421
Base content per 1 kb (bases) 449 551 353 97 245 306
Base content (%) 44.9% 55.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 141 156 106 35 67 89
Base content per 1 kb (bases) 475 525 357 118 226 300
Base content (%) 47.5% 52.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 815 1000 624 191 405 595
Base content per 1 kb (bases) 449 551 344 105 223 328
Base content (%) 44.9% 55.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 243 279 192 51 66 213
Base content per 1 kb (bases) 466 534 368 98 126 408
Base content (%) 46.6% 53.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 26 (11.45%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 9 7 19 25 0 11 8 0 0 4 4 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 7 7 0 2 3 3 0 4 4 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 1 1 1 5 0 1 3 1 2 0 0 0 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 3 0 1 2 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 85 72 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 34 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 89 108 28
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLIMLVSWMTFSLIIQPKLLSFTSTNPPHTTLKTTTKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 12 (21.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 1 3 2 0 1 2 0 0 0 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 1 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 2 0 1 0 3 0 0 0 0 0 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 17 24 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 10 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 17 27 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 43 (8.33%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 29 25 6 13 29 1 10 9 0 4 15 14 1 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 8 24 14 0 5 19 21 2 3 10 16 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 18 0 5 8 11 0 0 3 4 14 0 1 2 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 3 12 8 1 0 2 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 116 136 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 144 94 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 220 208 79
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 15 9 5 9 10 3 2 8 0 2 7 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 8 5 0 0 3 5 0 1 7 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 3 6 6 0 1 2 3 5 0 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 1 3 10 4 0 0 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 59 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 102 91 29
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 15 7 3 7 19 1 3 8 0 2 4 6 0 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 7 14 0 0 5 14 0 1 5 7 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 2 7 4 0 1 4 2 9 0 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 1 3 4 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 71 61 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 115 123 21
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 25 (6.58%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 32 (8.42%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.95%)
Leucine (Leu, L)
n = 69 (18.16%)
Isoleucine (Ile, I)
n = 29 (7.63%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 22 7 6 22 36 2 3 7 1 3 5 7 0 5 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 16 7 0 1 10 12 2 3 12 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 0 4 6 13 0 0 1 4 10 1 0 4 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 2 4 9 1 1 4 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 120 101 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 105 79 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 180 144 48
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 28 (8.62%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 24 (7.38%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 10 (3.08%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 26 (8.0%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 27 (8.31%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 16 11 7 15 29 3 10 5 0 0 1 8 1 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 12 13 0 2 5 5 1 6 13 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 5 1 7 10 6 0 0 5 2 12 2 2 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 7 0 0 4 4 0 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 96 87 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 102 55 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 132 127 53
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 52 (15.03%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 15 10 15 35 6 4 8 1 2 1 3 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 11 8 1 0 4 6 1 0 10 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 22 1 1 12 13 0 0 5 0 6 1 0 2 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 2 0 1 2 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 109 130 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 134 154 42
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 52 (15.03%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 15 10 15 35 6 4 8 1 2 1 3 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 11 8 1 0 4 6 1 0 10 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 22 1 1 12 13 0 0 5 0 6 1 0 2 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 2 0 1 2 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 109 130 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 134 154 42
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 54 (11.79%)
Cysteine (Cys, C)
n = 2 (0.44%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 100 (21.83%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 30 (6.55%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 22 9 31 45 3 12 14 0 0 3 3 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 16 13 0 1 8 8 2 9 12 8 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 21 0 2 14 10 0 0 9 6 8 1 0 2 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 1 2 8 1 0 4 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 160 149 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 141 79 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 185 193 71
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 2 (2.04%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 6 1 3 15 0 1 2 0 0 0 2 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 0 6 2 0 1 2 1 0 0 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 1 4 5 1 0 4 0 2 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 0 0 0 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 32 27 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 18 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 44 44 8
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 46 (7.62%)
Serine (Ser, S)
n = 48 (7.95%)
Threonine (Thr, T)
n = 75 (12.42%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 10 (1.66%)
Leucine (Leu, L)
n = 103 (17.05%)
Isoleucine (Ile, I)
n = 49 (8.11%)
Methionine (Met, M)
n = 32 (5.3%)
Proline (Pro, P)
n = 32 (5.3%)
Phenylalanine (Phe, F)
n = 34 (5.63%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 32 (5.3%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 36 31 11 27 51 2 12 20 0 1 3 6 0 11 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 5 31 9 1 1 11 19 1 1 11 20 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 31 1 2 20 14 0 1 11 0 11 2 0 3 29 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 3 6 21 0 0 5 3 1 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 165 222 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 189 117 228
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 270 256 67
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 32 (18.5%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 1 2 0 2 0 8 0 0 14 0 8 10 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 5 0 3 3 7 0 2 20 3 2 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 1 1 4 1 0 7 0 3 15 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 5 0 0 1 1 0 2 3 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 15 20 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 30 18 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 6 28 72
Total protein-coding genes (size: 11918 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 249 (6.27%)
Alanine (Ala, A)
n = 288 (7.25%)
Serine (Ser, S)
n = 291 (7.33%)
Threonine (Thr, T)
n = 383 (9.64%)
Cysteine (Cys, C)
n = 28 (0.71%)
Valine (Val, V)
n = 183 (4.61%)
Leucine (Leu, L)
n = 699 (17.6%)
Isoleucine (Ile, I)
n = 293 (7.38%)
Methionine (Met, M)
n = 174 (4.38%)
Proline (Pro, P)
n = 237 (5.97%)
Phenylalanine (Phe, F)
n = 230 (5.79%)
Tyrosine (Tyr, Y)
n = 117 (2.95%)
Tryptophan (Trp, W)
n = 111 (2.8%)
Aspartic acid (Asp, D)
n = 70 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.39%)
Asparagine (Asn, N)
n = 139 (3.5%)
Glutamine (Gln, Q)
n = 97 (2.44%)
Histidine (His, H)
n = 107 (2.69%)
Lysine (Lys, K)
n = 88 (2.22%)
Arginine (Arg, R)
n = 81 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
95 198 148 74 170 309 21 90 94 3 42 43 76 22 79 151
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 5 23 36 143 101 8 29 71 99 50 35 94 101 7 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 152 4 39 97 92 9 7 47 37 80 13 35 21 118 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 83 12 24 46 81 7 5 27 42 7 2 3 6 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
885 1096 1136 855
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
528 1145 720 1579
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
228 1557 1574 613

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.