Viewing data for Harengula jaguana


Scientific name Harengula jaguana
Common name Scaled herring
Maximum lifespan 3.00 years (Harengula jaguana@AnAge)

Total mtDNA (size: 17158 bases) GC AT G C A T
Base content (bases) 8449 8709 4965 3484 4447 4262
Base content per 1 kb (bases) 492 508 289 203 259 248
Base content (%) 49.2% 50.8%
Total protein-coding genes (size: 11404 bases) GC AT G C A T
Base content (bases) 5696 5708 3455 2241 3111 2597
Base content per 1 kb (bases) 499 501 303 197 273 228
Base content (%) 49.9% 50.1%
D-loop (size: 1494 bases) GC AT G C A T
Base content (bases) 644 850 376 268 437 413
Base content per 1 kb (bases) 431 569 252 179 293 276
Base content (%) 43.1% 56.9%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 749 802 408 341 367 435
Base content per 1 kb (bases) 483 517 263 220 237 280
Base content (%) 48.3% 51.7%
Total rRNA-coding genes (size: 2640 bases) GC AT G C A T
Base content (bases) 1323 1317 703 620 517 800
Base content per 1 kb (bases) 501 499 266 235 196 303
Base content (%) 50.1% 49.9%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 489 464 257 232 192 272
Base content per 1 kb (bases) 513 487 270 243 201 285
Base content (%) 51.3% 48.7%
16S rRNA gene (size: 1687 bases) GC AT G C A T
Base content (bases) 834 853 446 388 325 528
Base content per 1 kb (bases) 494 506 264 230 193 313
Base content (%) 49.4% 50.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 337 347 212 125 194 153
Base content per 1 kb (bases) 493 507 310 183 284 224
Base content (%) 49.3% 50.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 81 87 52 29 44 43
Base content per 1 kb (bases) 482 518 310 173 262 256
Base content (%) 48.2% 51.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 758 793 427 331 446 347
Base content per 1 kb (bases) 489 511 275 213 288 224
Base content (%) 48.9% 51.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 333 358 198 135 183 175
Base content per 1 kb (bases) 482 518 287 195 265 253
Base content (%) 48.2% 51.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 405 380 251 154 207 173
Base content per 1 kb (bases) 516 484 320 196 264 220
Base content (%) 51.6% 48.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 557 584 329 228 332 252
Base content per 1 kb (bases) 488 512 288 200 291 221
Base content (%) 48.8% 51.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 505 470 311 194 287 183
Base content per 1 kb (bases) 518 482 319 199 294 188
Base content (%) 51.8% 48.2%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 560 486 357 203 256 230
Base content per 1 kb (bases) 535 465 341 194 245 220
Base content (%) 53.5% 46.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 173 176 112 61 111 65
Base content per 1 kb (bases) 496 504 321 175 318 186
Base content (%) 49.6% 50.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 693 688 422 271 387 301
Base content per 1 kb (bases) 502 498 306 196 280 218
Base content (%) 50.2% 49.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 155 142 92 63 73 69
Base content per 1 kb (bases) 522 478 310 212 246 232
Base content (%) 52.2% 47.8%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 896 940 553 343 504 436
Base content per 1 kb (bases) 488 512 301 187 275 237
Base content (%) 48.8% 51.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 249 273 142 107 93 180
Base content per 1 kb (bases) 477 523 272 205 178 345
Base content (%) 47.7% 52.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.29%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 51 (22.47%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 5 17 5 15 12 1 6 3 3 7 3 5 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 9 4 3 0 1 7 4 4 8 4 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 4 2 2 1 0 1 0 4 2 3 4 1 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 0 1 1 1 2 2 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 84 64 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 60 33 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 68 56 59
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVIPPKILAHTFNNQPTSVGAEKTKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 0 1 0 0 0 1 1 1 0 2 2 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 0 1 0 0 0 1 4 3 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 0 0 1 0 3 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 2 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 13 15 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 14 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 20 14 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 34 (6.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 18 2 19 11 21 7 4 5 3 9 11 9 14 10 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 0 1 14 16 18 1 6 11 11 18 9 11 6 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 2 4 5 8 8 1 4 7 12 3 1 10 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 4 7 7 7 7 2 0 1 6 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 121 124 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
91 170 128 128
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 19 (8.3%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 3 (1.31%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 5 9 6 7 4 2 5 3 7 6 5 2 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 2 3 7 5 1 0 2 6 1 4 5 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 3 8 2 1 1 3 2 7 2 1 1 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 7 3 11 3 1 0 0 3 3 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 52 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 81 60 54
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 9 1 8 5 6 9 3 6 2 4 10 4 2 4 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 9 5 3 5 5 9 4 3 7 2 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 7 0 4 0 6 1 1 2 0 11 2 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 1 2 3 2 0 1 1 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 69 49 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 70 52 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 112 71 47
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 36 (9.5%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 19 (5.01%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 26 (6.86%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 1 13 10 20 10 4 5 1 9 3 10 4 7 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 8 14 8 6 5 5 7 10 6 6 3 6 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 5 2 5 4 8 6 0 2 3 11 4 2 5 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 5 6 2 7 1 0 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 100 84 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 99 76 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 130 92 89
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 37 (11.42%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.86%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 9 (2.78%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 8 (2.47%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 2 17 16 10 10 2 2 4 6 6 3 4 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 5 20 8 4 2 8 3 6 10 9 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 2 2 4 9 2 2 1 2 5 7 3 7 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 7 3 1 3 5 0 0 5 3 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 96 71 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 56 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 118 56 86
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 47 (13.54%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 11 5 12 17 11 14 4 6 6 3 7 2 5 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 6 28 10 3 6 3 4 5 7 8 2 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 13 6 4 9 2 2 1 4 3 5 5 4 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 2 4 0 1 5 4 1 0 2 2 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 100 100 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 125 55 125
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 132 74 71
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 47 (13.54%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 11 5 12 17 11 14 4 6 6 3 7 2 5 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 6 28 10 3 6 3 4 5 7 8 2 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 13 6 4 9 2 2 1 4 3 5 5 4 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 2 4 0 1 5 4 1 0 2 2 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 100 100 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 125 55 125
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 132 74 71
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (6.75%)
Alanine (Ala, A)
n = 42 (9.15%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 23 (5.01%)
Leucine (Leu, L)
n = 88 (19.17%)
Isoleucine (Ile, I)
n = 33 (7.19%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 15 12 26 19 14 12 9 8 2 9 6 5 3 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 2 2 9 19 8 6 3 12 5 11 9 15 4 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 8 7 0 10 5 6 2 4 3 11 9 8 6 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 6 1 3 7 3 2 1 5 3 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 131 124 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 131 71 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
88 160 106 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 16 (16.33%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 5 2 8 3 3 3 1 0 0 2 2 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 8 6 0 0 4 1 2 0 0 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 1 2 0 1 4 0 1 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 2 1 0 0 0 1 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
31 29 20 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 26 15 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 37 34 15
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.56%)
Alanine (Ala, A)
n = 58 (9.49%)
Serine (Ser, S)
n = 44 (7.2%)
Threonine (Thr, T)
n = 58 (9.49%)
Cysteine (Cys, C)
n = 8 (1.31%)
Valine (Val, V)
n = 33 (5.4%)
Leucine (Leu, L)
n = 84 (13.75%)
Isoleucine (Ile, I)
n = 53 (8.67%)
Methionine (Met, M)
n = 27 (4.42%)
Proline (Pro, P)
n = 30 (4.91%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 15 (2.45%)
Aspartic acid (Asp, D)
n = 15 (2.45%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 26 (4.26%)
Glutamine (Gln, Q)
n = 18 (2.95%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 21 (3.44%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 25 6 18 18 25 9 7 10 8 7 10 9 7 13 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
21 4 4 12 27 12 7 3 12 9 10 9 9 7 5 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 7 6 10 15 4 3 3 9 4 9 9 7 7 19 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 7 7 8 10 11 1 2 6 2 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 143 197 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 178 118 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
113 232 121 146
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (9.25%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 9 (5.2%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 9 (5.2%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 2 (1.16%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 1 7 1 6 2 7 0 2 5 7 5 6 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 5 5 5 2 6 3 3 4 1 4 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 3 1 0 3 3 3 2 4 4 3 4 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 0 2 0 1 1 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 27 32 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 39 24 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 41 37 52
Total protein-coding genes (size: 11426 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 248 (6.52%)
Alanine (Ala, A)
n = 368 (9.67%)
Serine (Ser, S)
n = 239 (6.28%)
Threonine (Thr, T)
n = 291 (7.65%)
Cysteine (Cys, C)
n = 32 (0.84%)
Valine (Val, V)
n = 256 (6.73%)
Leucine (Leu, L)
n = 613 (16.11%)
Isoleucine (Ile, I)
n = 269 (7.07%)
Methionine (Met, M)
n = 150 (3.94%)
Proline (Pro, P)
n = 218 (5.73%)
Phenylalanine (Phe, F)
n = 234 (6.15%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 76 (2.0%)
Glutamic acid (Glu, E)
n = 102 (2.68%)
Asparagine (Asn, N)
n = 111 (2.92%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 104 (2.73%)
Lysine (Lys, K)
n = 78 (2.05%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
143 126 43 158 118 147 98 52 60 36 63 77 59 57 77 157
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
107 10 22 74 167 89 38 37 68 67 76 68 92 37 21 70
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
124 65 32 39 66 47 33 14 40 33 84 46 40 42 69 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 46 56 29 47 41 37 10 6 41 19 0 0 5 2 75
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1050 1015 953 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
531 1062 691 1522
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
698 1346 874 888

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.