Viewing data for Stenodus leucichthys


Scientific name Stenodus leucichthys
Common name Inconnu
Maximum lifespan 22.00 years (Stenodus leucichthys@AnAge)

Total mtDNA (size: 16864 bases) GC AT G C A T
Base content (bases) 7960 8904 4945 3015 4356 4548
Base content per 1 kb (bases) 472 528 293 179 258 270
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11411 bases) GC AT G C A T
Base content (bases) 5435 5976 3547 1888 3066 2910
Base content per 1 kb (bases) 476 524 311 165 269 255
Base content (%) 47.6% 52.4%
D-loop (size: 1204 bases) GC AT G C A T
Base content (bases) 464 740 291 173 371 369
Base content per 1 kb (bases) 385 615 242 144 308 306
Base content (%) 38.5% 61.5%
Total tRNA-coding genes (size: 1555 bases) GC AT G C A T
Base content (bases) 721 834 396 325 386 448
Base content per 1 kb (bases) 464 536 255 209 248 288
Base content (%) 46.4% 53.6%
Total rRNA-coding genes (size: 2626 bases) GC AT G C A T
Base content (bases) 1298 1328 687 611 519 809
Base content per 1 kb (bases) 494 506 262 233 198 308
Base content (%) 49.4% 50.6%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 476 471 257 219 194 277
Base content per 1 kb (bases) 503 497 271 231 205 293
Base content (%) 50.3% 49.7%
16S rRNA gene (size: 1679 bases) GC AT G C A T
Base content (bases) 822 857 430 392 325 532
Base content per 1 kb (bases) 490 510 256 233 194 317
Base content (%) 49.0% 51.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 326 358 227 99 186 172
Base content per 1 kb (bases) 477 523 332 145 272 251
Base content (%) 47.7% 52.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 82 86 58 24 40 46
Base content per 1 kb (bases) 488 512 345 143 238 274
Base content (%) 48.8% 51.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 729 822 425 304 466 356
Base content per 1 kb (bases) 470 530 274 196 300 230
Base content (%) 47.0% 53.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 311 380 194 117 194 186
Base content per 1 kb (bases) 450 550 281 169 281 269
Base content (%) 45.0% 55.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 379 406 242 137 219 187
Base content per 1 kb (bases) 483 517 308 175 279 238
Base content (%) 48.3% 51.7%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 547 594 356 191 319 275
Base content per 1 kb (bases) 479 521 312 167 280 241
Base content (%) 47.9% 52.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 471 504 299 172 276 228
Base content per 1 kb (bases) 483 517 307 176 283 234
Base content (%) 48.3% 51.7%
ND2 (size: 1050 bases) GC AT G C A T
Base content (bases) 500 550 347 153 270 280
Base content per 1 kb (bases) 476 524 330 146 257 267
Base content (%) 47.6% 52.4%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 167 182 106 61 107 75
Base content per 1 kb (bases) 479 521 304 175 307 215
Base content (%) 47.9% 52.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 642 739 430 212 371 368
Base content per 1 kb (bases) 465 535 311 154 269 266
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 154 143 100 54 75 68
Base content per 1 kb (bases) 519 481 337 182 253 229
Base content (%) 51.9% 48.1%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 868 971 579 289 484 487
Base content per 1 kb (bases) 472 528 315 157 263 265
Base content (%) 47.2% 52.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 264 258 187 77 65 193
Base content per 1 kb (bases) 506 494 358 148 125 370
Base content (%) 50.6% 49.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 11 6 18 9 17 4 5 8 1 5 4 3 2 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 8 8 0 0 6 1 4 1 6 8 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 2 2 1 0 0 0 4 0 4 1 0 2 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 0 1 0 2 2 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 83 66 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 61 32 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 83 74 47
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVIPPKVLGHTFTNEPTSQSTEKAKPEPWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 0 1 1 1 1 0 2 0 2 1 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 0 0 0 1 0 0 2 6 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 1 0 0 1 1 0 1 0 0 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 17 15 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 19 14 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 22 17 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 27 (5.23%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 18 12 18 10 10 11 11 5 3 11 14 10 4 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 0 7 27 10 5 11 11 14 11 6 10 6 5 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 2 5 12 6 1 0 5 7 11 4 2 7 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 3 7 7 8 0 1 0 4 3 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 111 130 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 93 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 177 133 141
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 19 (8.3%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 9 14 5 5 1 2 7 1 6 6 3 5 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 5 6 1 2 0 6 1 2 10 2 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 7 3 3 0 1 2 3 6 1 1 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 12 3 5 8 4 1 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 63 53 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 77 69 66
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 4 4 8 6 11 2 4 7 2 3 7 4 3 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 3 11 7 0 5 12 3 2 1 9 2 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 4 3 3 1 1 2 2 10 1 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 3 2 3 2 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 69 52 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 107 78 58
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 35 (9.23%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 26 (6.86%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 16 6 9 17 16 6 6 5 1 5 11 7 3 10 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 5 19 10 1 4 9 9 5 2 12 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 7 6 7 1 0 1 3 11 0 3 5 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 6 5 4 5 0 0 7 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 95 89 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 100 75 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 161 111 75
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 24 (7.41%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 21 (6.48%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 9 (2.78%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 7 19 14 16 4 7 5 2 7 6 9 2 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 7 18 8 2 0 6 6 7 3 14 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 3 3 4 8 1 0 5 6 6 3 2 5 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 4 2 2 5 2 1 1 3 3 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 96 73 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 96 55 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 107 100 79
ND2 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.87%)
Alanine (Ala, A)
n = 41 (11.75%)
Serine (Ser, S)
n = 23 (6.59%)
Threonine (Thr, T)
n = 40 (11.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.3%)
Leucine (Leu, L)
n = 76 (21.78%)
Isoleucine (Ile, I)
n = 21 (6.02%)
Methionine (Met, M)
n = 17 (4.87%)
Proline (Pro, P)
n = 19 (5.44%)
Phenylalanine (Phe, F)
n = 10 (2.87%)
Tyrosine (Tyr, Y)
n = 8 (2.29%)
Tryptophan (Trp, W)
n = 12 (3.44%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 12 (3.44%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 8 (2.29%)
Arginine (Arg, R)
n = 5 (1.43%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 12 16 18 19 11 10 10 2 6 4 5 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 5 22 13 1 2 5 7 3 6 6 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 9 2 1 8 7 1 0 6 3 5 1 2 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 6 2 1 0 3 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 106 102 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 117 53 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 124 125 70
ND3 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.87%)
Alanine (Ala, A)
n = 41 (11.75%)
Serine (Ser, S)
n = 23 (6.59%)
Threonine (Thr, T)
n = 40 (11.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.3%)
Leucine (Leu, L)
n = 76 (21.78%)
Isoleucine (Ile, I)
n = 21 (6.02%)
Methionine (Met, M)
n = 17 (4.87%)
Proline (Pro, P)
n = 19 (5.44%)
Phenylalanine (Phe, F)
n = 10 (2.87%)
Tyrosine (Tyr, Y)
n = 8 (2.29%)
Tryptophan (Trp, W)
n = 12 (3.44%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 12 (3.44%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 8 (2.29%)
Arginine (Arg, R)
n = 5 (1.43%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 12 16 18 19 11 10 10 2 6 4 5 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 5 22 13 1 2 5 7 3 6 6 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 9 2 1 8 7 1 0 6 3 5 1 2 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 6 2 1 0 3 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 106 102 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 117 53 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 124 125 70
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (5.88%)
Alanine (Ala, A)
n = 35 (7.63%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 42 (9.15%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 14 (3.05%)
Leucine (Leu, L)
n = 98 (21.35%)
Isoleucine (Ile, I)
n = 35 (7.63%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 20 20 23 21 31 8 12 9 3 1 7 5 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 3 6 17 12 0 4 10 11 2 4 15 7 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 4 3 13 5 0 3 6 4 9 9 3 6 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 4 1 4 6 4 3 1 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 144 134 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 124 75 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 162 159 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 4 5 7 7 3 0 3 0 1 0 3 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 8 6 0 1 3 3 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 1 1 1 4 0 0 2 1 0 1 1 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 0 2 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
29 34 17 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 37 37 16
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.23%)
Alanine (Ala, A)
n = 50 (8.17%)
Serine (Ser, S)
n = 45 (7.35%)
Threonine (Thr, T)
n = 64 (10.46%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 34 (5.56%)
Leucine (Leu, L)
n = 98 (16.01%)
Isoleucine (Ile, I)
n = 41 (6.7%)
Methionine (Met, M)
n = 29 (4.74%)
Proline (Pro, P)
n = 29 (4.74%)
Phenylalanine (Phe, F)
n = 39 (6.37%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 14 (2.29%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 31 (5.07%)
Glutamine (Gln, Q)
n = 21 (3.43%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 14 25 22 24 13 10 15 6 13 8 10 3 18 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 1 5 8 30 12 0 8 8 10 6 5 17 5 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
38 18 5 8 10 13 1 0 13 3 6 6 4 5 26 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 3 6 8 11 9 1 0 7 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 159 198 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 175 123 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 245 166 128
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 31 (17.92%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 3 (1.73%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 2 5 0 5 2 6 0 0 8 2 5 16 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 7 5 3 4 8 3 1 12 2 1 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 5 0 3 3 1 1 7 1 3 12 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 6 3 0 0 1 0 1 1 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 22 13 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 39 21 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 16 31 62
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 249 (6.54%)
Alanine (Ala, A)
n = 349 (9.16%)
Serine (Ser, S)
n = 237 (6.22%)
Threonine (Thr, T)
n = 309 (8.11%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 245 (6.43%)
Leucine (Leu, L)
n = 649 (17.04%)
Isoleucine (Ile, I)
n = 257 (6.75%)
Methionine (Met, M)
n = 159 (4.18%)
Proline (Pro, P)
n = 212 (5.57%)
Phenylalanine (Phe, F)
n = 224 (5.88%)
Tyrosine (Tyr, Y)
n = 110 (2.89%)
Tryptophan (Trp, W)
n = 123 (3.23%)
Aspartic acid (Asp, D)
n = 79 (2.07%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 113 (2.97%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
132 125 97 170 130 170 69 77 78 22 70 70 66 39 107 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
62 13 14 60 178 97 14 45 76 74 54 34 113 52 13 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
131 103 21 48 65 60 10 6 48 40 70 32 33 38 75 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
88 69 34 34 45 49 26 8 10 42 16 0 0 7 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1025 1032 967 785
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
529 1053 693 1534
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
446 1355 1132 876

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.