Viewing data for Neoceratodus forsteri


Scientific name Neoceratodus forsteri
Common name Australian lungfish
Maximum lifespan 19.70 years (Neoceratodus forsteri@AnAge)

Total mtDNA (size: 16572 bases) GC AT G C A T
Base content (bases) 7096 9476 4475 2621 4056 5420
Base content per 1 kb (bases) 428 572 270 158 245 327
Base content (%) 42.8% 57.2%
Total protein-coding genes (size: 11511 bases) GC AT G C A T
Base content (bases) 5004 6507 3293 1711 2826 3681
Base content per 1 kb (bases) 435 565 286 149 246 320
Base content (%) 43.5% 56.5%
D-loop (size: 926 bases) GC AT G C A T
Base content (bases) 329 597 197 132 302 295
Base content per 1 kb (bases) 355 645 213 143 326 319
Base content (%) 35.5% 64.5%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 656 890 374 282 383 507
Base content per 1 kb (bases) 424 576 242 182 248 328
Base content (%) 42.4% 57.6%
Total rRNA-coding genes (size: 2632 bases) GC AT G C A T
Base content (bases) 1118 1514 611 507 558 956
Base content per 1 kb (bases) 425 575 232 193 212 363
Base content (%) 42.5% 57.5%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 434 518 240 194 196 322
Base content per 1 kb (bases) 456 544 252 204 206 338
Base content (%) 45.6% 54.4%
16S rRNA gene (size: 1680 bases) GC AT G C A T
Base content (bases) 684 996 371 313 362 634
Base content per 1 kb (bases) 407 593 221 186 215 377
Base content (%) 40.7% 59.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 301 383 204 97 169 214
Base content per 1 kb (bases) 440 560 298 142 247 313
Base content (%) 44.0% 56.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 52 18 40 58
Base content per 1 kb (bases) 417 583 310 107 238 345
Base content (%) 41.7% 58.3%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 722 835 428 294 432 403
Base content per 1 kb (bases) 464 536 275 189 277 259
Base content (%) 46.4% 53.6%
COX2 (size: 705 bases) GC AT G C A T
Base content (bases) 301 404 187 114 181 223
Base content per 1 kb (bases) 427 573 265 162 257 316
Base content (%) 42.7% 57.3%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 369 417 226 143 194 223
Base content per 1 kb (bases) 469 531 288 182 247 284
Base content (%) 46.9% 53.1%
CYTB (size: 1200 bases) GC AT G C A T
Base content (bases) 519 681 339 180 309 372
Base content per 1 kb (bases) 433 568 283 150 258 310
Base content (%) 43.3% 56.8%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 435 537 292 143 230 307
Base content per 1 kb (bases) 448 552 300 147 237 316
Base content (%) 44.8% 55.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 419 625 306 113 234 391
Base content per 1 kb (bases) 401 599 293 108 224 375
Base content (%) 40.1% 59.9%
ND3 (size: 393 bases) GC AT G C A T
Base content (bases) 178 215 119 59 99 116
Base content per 1 kb (bases) 453 547 303 150 252 295
Base content (%) 45.3% 54.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 581 800 385 196 346 454
Base content per 1 kb (bases) 421 579 279 142 251 329
Base content (%) 42.1% 57.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 132 165 85 47 77 88
Base content per 1 kb (bases) 444 556 286 158 259 296
Base content (%) 44.4% 55.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 777 1053 528 249 444 609
Base content per 1 kb (bases) 425 575 289 136 243 333
Base content (%) 42.5% 57.5%
ND6 (size: 516 bases) GC AT G C A T
Base content (bases) 205 311 145 60 77 234
Base content per 1 kb (bases) 397 603 281 116 149 453
Base content (%) 39.7% 60.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 48 (21.15%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 6 (2.64%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 5 4 6 25 6 7 10 1 3 1 9 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 5 9 1 0 4 4 3 2 3 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 0 2 1 0 0 5 0 3 1 0 5 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 2 0 1 1 0 0 0 5 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 78 71 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 60 35 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 66 108 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLMILMLSWIGFLLILASKIIAHTYLNEPTTQNTEKLTAQPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 4 0 2 1 2 2 1 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 0 0 0 0 1 0 0 2 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 1 0 0 0 0 1 0 1 1 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 1 1 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 22 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 17 14 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 18 22 11
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.27%)
Alanine (Ala, A)
n = 41 (7.92%)
Serine (Ser, S)
n = 31 (5.98%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.14%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 44 (8.49%)
Methionine (Met, M)
n = 28 (5.41%)
Proline (Pro, P)
n = 29 (5.6%)
Phenylalanine (Phe, F)
n = 39 (7.53%)
Tyrosine (Tyr, Y)
n = 18 (3.47%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 20 (3.86%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 21 23 4 8 24 14 7 7 2 12 11 9 5 23 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 15 15 4 5 20 13 10 6 5 15 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 3 7 9 6 5 0 4 6 12 5 4 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 2 2 12 7 1 2 0 7 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 117 137 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 176 170 109
COX2 (size: 705 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.27%)
Alanine (Ala, A)
n = 14 (5.98%)
Serine (Ser, S)
n = 22 (9.4%)
Threonine (Thr, T)
n = 13 (5.56%)
Cysteine (Cys, C)
n = 2 (0.85%)
Valine (Val, V)
n = 20 (8.55%)
Leucine (Leu, L)
n = 26 (11.11%)
Isoleucine (Ile, I)
n = 18 (7.69%)
Methionine (Met, M)
n = 13 (5.56%)
Proline (Pro, P)
n = 13 (5.56%)
Phenylalanine (Phe, F)
n = 9 (3.85%)
Tyrosine (Tyr, Y)
n = 9 (3.85%)
Tryptophan (Trp, W)
n = 5 (2.14%)
Aspartic acid (Asp, D)
n = 12 (5.13%)
Glutamic acid (Glu, E)
n = 14 (5.98%)
Asparagine (Asn, N)
n = 5 (2.14%)
Glutamine (Gln, Q)
n = 9 (3.85%)
Histidine (His, H)
n = 10 (4.27%)
Lysine (Lys, K)
n = 4 (1.71%)
Arginine (Arg, R)
n = 6 (2.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 11 3 4 7 4 8 8 1 0 9 9 2 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 4 4 2 1 3 6 0 1 2 8 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 9 0 3 5 10 0 0 4 4 5 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 4 2 10 4 0 3 1 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 56 57 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 64 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 73 102 43
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 21 (8.05%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.66%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 12 (4.6%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 6 2 6 17 5 4 8 0 2 5 10 3 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 9 12 0 2 1 10 8 1 3 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 0 3 8 0 0 3 3 8 1 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 1 2 3 3 0 1 0 3 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 71 49 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 88 119 33
CYTB (size: 1200 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.02%)
Alanine (Ala, A)
n = 26 (6.52%)
Serine (Ser, S)
n = 24 (6.02%)
Threonine (Thr, T)
n = 26 (6.52%)
Cysteine (Cys, C)
n = 5 (1.25%)
Valine (Val, V)
n = 25 (6.27%)
Leucine (Leu, L)
n = 60 (15.04%)
Isoleucine (Ile, I)
n = 31 (7.77%)
Methionine (Met, M)
n = 12 (3.01%)
Proline (Pro, P)
n = 24 (6.02%)
Phenylalanine (Phe, F)
n = 30 (7.52%)
Tyrosine (Tyr, Y)
n = 16 (4.01%)
Tryptophan (Trp, W)
n = 13 (3.26%)
Aspartic acid (Asp, D)
n = 10 (2.51%)
Glutamic acid (Glu, E)
n = 6 (1.5%)
Asparagine (Asn, N)
n = 21 (5.26%)
Glutamine (Gln, Q)
n = 7 (1.75%)
Histidine (His, H)
n = 12 (3.01%)
Lysine (Lys, K)
n = 14 (3.51%)
Arginine (Arg, R)
n = 9 (2.26%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 22 10 5 8 36 4 7 5 2 5 4 13 3 8 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 3 11 11 1 1 5 20 2 4 2 15 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 0 3 7 9 1 2 2 2 14 1 0 5 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 2 8 8 6 0 0 8 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 105 108 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 96 87 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 138 177 59
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 26 (8.05%)
Serine (Ser, S)
n = 20 (6.19%)
Threonine (Thr, T)
n = 27 (8.36%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.88%)
Leucine (Leu, L)
n = 63 (19.5%)
Isoleucine (Ile, I)
n = 20 (6.19%)
Methionine (Met, M)
n = 18 (5.57%)
Proline (Pro, P)
n = 23 (7.12%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 10 (3.1%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 5 (1.55%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 13 (4.02%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 4 (1.24%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 14 13 4 1 45 8 4 6 0 4 6 8 1 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 1 11 13 1 0 7 7 4 2 4 16 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 0 3 6 7 1 0 3 3 7 2 1 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 0 5 7 0 1 1 6 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 99 88 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 93 57 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 100 162 36
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 55 (15.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 31 8 7 36 3 3 11 2 1 3 2 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 13 11 1 0 5 9 1 0 2 13 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 31 0 0 5 11 0 3 4 1 5 0 2 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 1 0 11 0 1 0 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 94 145 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 118 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 94 188 50
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 55 (15.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 31 8 7 36 3 3 11 2 1 3 2 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 13 11 1 0 5 9 1 0 2 13 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 31 0 0 5 11 0 3 4 1 5 0 2 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 1 0 11 0 1 0 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 94 145 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 118 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 94 188 50
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.45%)
Alanine (Ala, A)
n = 38 (8.28%)
Serine (Ser, S)
n = 20 (4.36%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 19 (4.14%)
Leucine (Leu, L)
n = 84 (18.3%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 34 (7.41%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 15 (3.27%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 21 24 9 10 49 5 10 14 1 6 4 9 0 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 5 6 15 17 0 1 9 11 4 2 2 22 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 3 4 1 8 2 1 4 4 10 5 1 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 1 5 12 1 1 1 7 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 138 147 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 119 83 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 128 224 73
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 6 2 3 13 2 4 2 2 0 0 2 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 1 4 7 1 0 2 2 1 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 0 2 4 0 0 2 0 0 0 0 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 1 0 0 0 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 30 23 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 14 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 25 51 14
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.09%)
Alanine (Ala, A)
n = 51 (8.37%)
Serine (Ser, S)
n = 45 (7.39%)
Threonine (Thr, T)
n = 61 (10.02%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.96%)
Leucine (Leu, L)
n = 92 (15.11%)
Isoleucine (Ile, I)
n = 54 (8.87%)
Methionine (Met, M)
n = 40 (6.57%)
Proline (Pro, P)
n = 24 (3.94%)
Phenylalanine (Phe, F)
n = 32 (5.25%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 15 (2.46%)
Aspartic acid (Asp, D)
n = 14 (2.3%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 27 (4.43%)
Glutamine (Gln, Q)
n = 28 (4.6%)
Histidine (His, H)
n = 13 (2.13%)
Lysine (Lys, K)
n = 25 (4.11%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 32 31 8 13 53 12 4 24 4 6 3 8 1 13 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 3 3 6 19 21 5 2 18 9 2 3 5 15 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 22 3 7 2 21 3 1 11 3 10 6 2 8 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 4 10 24 1 0 2 6 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 160 219 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 169 132 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 199 258 102
ND6 (size: 516 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.28%)
Alanine (Ala, A)
n = 14 (8.19%)
Serine (Ser, S)
n = 15 (8.77%)
Threonine (Thr, T)
n = 4 (2.34%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 26 (15.2%)
Leucine (Leu, L)
n = 33 (19.3%)
Isoleucine (Ile, I)
n = 6 (3.51%)
Methionine (Met, M)
n = 5 (2.92%)
Proline (Pro, P)
n = 4 (2.34%)
Phenylalanine (Phe, F)
n = 16 (9.36%)
Tyrosine (Tyr, Y)
n = 7 (4.09%)
Tryptophan (Trp, W)
n = 4 (2.34%)
Aspartic acid (Asp, D)
n = 4 (2.34%)
Glutamic acid (Glu, E)
n = 4 (2.34%)
Asparagine (Asn, N)
n = 3 (1.75%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 0 4 0 4 2 15 0 0 13 1 3 9 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 6 1 2 5 8 2 5 6 1 0 2 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 9 1 1 0 3 1 6 1 2 8 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 4 3 1 0 0 2 0 1 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 18 22 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 33 20 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 9 35 85
Total protein-coding genes (size: 11533 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 240 (6.25%)
Alanine (Ala, A)
n = 306 (7.96%)
Serine (Ser, S)
n = 241 (6.27%)
Threonine (Thr, T)
n = 334 (8.69%)
Cysteine (Cys, C)
n = 30 (0.78%)
Valine (Val, V)
n = 209 (5.44%)
Leucine (Leu, L)
n = 621 (16.16%)
Isoleucine (Ile, I)
n = 288 (7.49%)
Methionine (Met, M)
n = 218 (5.67%)
Proline (Pro, P)
n = 206 (5.36%)
Phenylalanine (Phe, F)
n = 218 (5.67%)
Tyrosine (Tyr, Y)
n = 110 (2.86%)
Tryptophan (Trp, W)
n = 121 (3.15%)
Aspartic acid (Asp, D)
n = 77 (2.0%)
Glutamic acid (Glu, E)
n = 97 (2.52%)
Asparagine (Asn, N)
n = 132 (3.43%)
Glutamine (Gln, Q)
n = 116 (3.02%)
Histidine (His, H)
n = 102 (2.65%)
Lysine (Lys, K)
n = 91 (2.37%)
Arginine (Arg, R)
n = 75 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
131 157 165 59 73 326 68 77 100 16 53 48 84 24 104 114
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
53 9 21 46 110 129 21 20 79 99 42 23 32 137 14 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
104 162 11 38 47 87 13 11 45 33 77 26 18 37 95 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
88 77 20 17 60 80 11 11 5 52 7 0 0 9 3 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
929 1025 1119 771
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
522 1031 737 1554
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
347 1155 1679 663

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.