Viewing data for Phelsuma guimbeaui


Scientific name Phelsuma guimbeaui
Common name Mauritius lowland forest day gecko
Maximum lifespan 7.10 years (Phelsuma guimbeaui@AnAge)

Total mtDNA (size: 17533 bases) GC AT G C A T
Base content (bases) 6934 10599 4615 2319 4684 5915
Base content per 1 kb (bases) 395 605 263 132 267 337
Base content (%) 39.5% 60.5%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4521 6820 3164 1357 3014 3806
Base content per 1 kb (bases) 399 601 279 120 266 336
Base content (%) 39.9% 60.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1524 bases) GC AT G C A T
Base content (bases) 600 924 351 249 412 512
Base content per 1 kb (bases) 394 606 230 163 270 336
Base content (%) 39.4% 60.6%
Total rRNA-coding genes (size: 2497 bases) GC AT G C A T
Base content (bases) 1006 1491 589 417 564 927
Base content per 1 kb (bases) 403 597 236 167 226 371
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 388 560 224 164 220 340
Base content per 1 kb (bases) 409 591 236 173 232 359
Base content (%) 40.9% 59.1%
16S rRNA gene (size: 1549 bases) GC AT G C A T
Base content (bases) 618 931 365 253 344 587
Base content per 1 kb (bases) 399 601 236 163 222 379
Base content (%) 39.9% 60.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 243 438 181 62 202 236
Base content per 1 kb (bases) 357 643 266 91 297 347
Base content (%) 35.7% 64.3%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 63 102 48 15 44 58
Base content per 1 kb (bases) 382 618 291 91 267 352
Base content (%) 38.2% 61.8%
COX1 (size: 1590 bases) GC AT G C A T
Base content (bases) 675 915 422 253 473 442
Base content per 1 kb (bases) 425 575 265 159 297 278
Base content (%) 42.5% 57.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 283 405 181 102 166 239
Base content per 1 kb (bases) 411 589 263 148 241 347
Base content (%) 41.1% 58.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 339 445 221 118 217 228
Base content per 1 kb (bases) 432 568 282 151 277 291
Base content (%) 43.2% 56.8%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 479 658 326 153 318 340
Base content per 1 kb (bases) 421 579 287 135 280 299
Base content (%) 42.1% 57.9%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 376 593 251 125 269 324
Base content per 1 kb (bases) 388 612 259 129 278 334
Base content (%) 38.8% 61.2%
ND2 (size: 1033 bases) GC AT G C A T
Base content (bases) 377 656 291 86 265 391
Base content per 1 kb (bases) 365 635 282 83 257 379
Base content (%) 36.5% 63.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 130 216 91 39 106 110
Base content per 1 kb (bases) 376 624 263 113 306 318
Base content (%) 37.6% 62.4%
ND4 (size: 1365 bases) GC AT G C A T
Base content (bases) 532 833 399 133 360 473
Base content per 1 kb (bases) 390 610 292 97 264 347
Base content (%) 39.0% 61.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 121 176 82 39 82 94
Base content per 1 kb (bases) 407 593 276 131 276 316
Base content (%) 40.7% 59.3%
ND5 (size: 1791 bases) GC AT G C A T
Base content (bases) 703 1088 510 193 441 647
Base content per 1 kb (bases) 393 607 285 108 246 361
Base content (%) 39.3% 60.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 208 311 164 44 76 235
Base content per 1 kb (bases) 401 599 316 85 146 453
Base content (%) 40.1% 59.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (1.77%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 11 (4.87%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 55 (24.34%)
Isoleucine (Ile, I)
n = 15 (6.64%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 7 (3.1%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 12 7 2 26 4 15 7 0 3 0 8 0 10 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 7 9 0 0 1 3 0 1 1 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 1 0 6 0 1 3 5 2 0 1 1 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 5 0 1 1 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 70 73 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 67 36 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 44 127 47
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPAPWLMTFIMSWTALFMIHNTMMKFYPINLIQHTHIQYQLTTPWTWSWQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.7%)
Serine (Ser, S)
n = 2 (3.7%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.26%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 6 (11.11%)
Proline (Pro, P)
n = 5 (9.26%)
Phenylalanine (Phe, F)
n = 3 (5.56%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.56%)
Glutamine (Gln, Q)
n = 5 (9.26%)
Histidine (His, H)
n = 3 (5.56%)
Lysine (Lys, K)
n = 1 (1.85%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 3 2 1 1 0 1 4 1 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 1 0 1 0 0 0 0 0 1 2 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 0 2 0 0 0 1 1 1 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 0 0 1 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 16 15 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 15 21 11
COX1 (size: 1590 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.7%)
Alanine (Ala, A)
n = 42 (7.94%)
Serine (Ser, S)
n = 33 (6.24%)
Threonine (Thr, T)
n = 37 (6.99%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 37 (6.99%)
Leucine (Leu, L)
n = 64 (12.1%)
Isoleucine (Ile, I)
n = 38 (7.18%)
Methionine (Met, M)
n = 32 (6.05%)
Proline (Pro, P)
n = 31 (5.86%)
Phenylalanine (Phe, F)
n = 42 (7.94%)
Tyrosine (Tyr, Y)
n = 17 (3.21%)
Tryptophan (Trp, W)
n = 16 (3.02%)
Aspartic acid (Asp, D)
n = 14 (2.65%)
Glutamic acid (Glu, E)
n = 10 (1.89%)
Asparagine (Asn, N)
n = 16 (3.02%)
Glutamine (Gln, Q)
n = 7 (1.32%)
Histidine (His, H)
n = 22 (4.16%)
Lysine (Lys, K)
n = 14 (2.65%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 30 11 8 22 6 15 7 0 8 5 19 5 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 8 16 17 1 10 19 12 5 5 12 14 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 0 8 8 12 0 2 3 7 10 1 2 7 9 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 6 8 12 2 2 6 1 0 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 116 142 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 101 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 168 199 137
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 19 (8.33%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 29 (12.72%)
Isoleucine (Ile, I)
n = 14 (6.14%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 9 (3.95%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 10 (4.39%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 15 5 2 11 4 6 10 0 2 0 11 2 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 4 10 1 1 1 4 2 1 3 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 0 1 3 7 0 2 6 3 6 1 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 3 10 3 0 2 0 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 59 66 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 58 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 61 115 40
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 9 4 0 20 1 6 6 0 5 7 3 1 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 6 9 0 3 6 10 1 2 1 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 1 3 7 0 0 4 3 6 1 0 0 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 2 2 1 1 0 3 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 62 67 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 69 49 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 90 112 51
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.35%)
Alanine (Ala, A)
n = 29 (7.67%)
Serine (Ser, S)
n = 23 (6.08%)
Threonine (Thr, T)
n = 21 (5.56%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.29%)
Leucine (Leu, L)
n = 53 (14.02%)
Isoleucine (Ile, I)
n = 34 (8.99%)
Methionine (Met, M)
n = 16 (4.23%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 31 (8.2%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 11 (2.91%)
Aspartic acid (Asp, D)
n = 6 (1.59%)
Glutamic acid (Glu, E)
n = 8 (2.12%)
Asparagine (Asn, N)
n = 21 (5.56%)
Glutamine (Gln, Q)
n = 9 (2.38%)
Histidine (His, H)
n = 10 (2.65%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 9 (2.38%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 23 15 12 4 23 2 12 8 1 2 4 12 2 14 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 3 16 8 2 2 9 12 1 1 8 16 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 5 6 8 0 1 3 6 9 3 0 6 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 2 4 10 0 0 3 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 94 106 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 94 80 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 138 154 72
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 22 (6.83%)
Serine (Ser, S)
n = 27 (8.39%)
Threonine (Thr, T)
n = 23 (7.14%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.35%)
Leucine (Leu, L)
n = 59 (18.32%)
Isoleucine (Ile, I)
n = 22 (6.83%)
Methionine (Met, M)
n = 24 (7.45%)
Proline (Pro, P)
n = 22 (6.83%)
Phenylalanine (Phe, F)
n = 17 (5.28%)
Tyrosine (Tyr, Y)
n = 11 (3.42%)
Tryptophan (Trp, W)
n = 11 (3.42%)
Aspartic acid (Asp, D)
n = 5 (1.55%)
Glutamic acid (Glu, E)
n = 12 (3.73%)
Asparagine (Asn, N)
n = 10 (3.11%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 22 5 6 28 3 12 9 0 3 3 7 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 5 13 1 0 7 8 1 1 5 16 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 2 5 16 0 1 3 6 5 1 5 5 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 1 1 4 8 0 1 2 5 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 82 91 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 90 57 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 79 176 52
ND2 (size: 1033 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.79%)
Alanine (Ala, A)
n = 17 (4.96%)
Serine (Ser, S)
n = 28 (8.16%)
Threonine (Thr, T)
n = 53 (15.45%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 5 (1.46%)
Leucine (Leu, L)
n = 54 (15.74%)
Isoleucine (Ile, I)
n = 29 (8.45%)
Methionine (Met, M)
n = 41 (11.95%)
Proline (Pro, P)
n = 23 (6.71%)
Phenylalanine (Phe, F)
n = 13 (3.79%)
Tyrosine (Tyr, Y)
n = 10 (2.92%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 8 (2.33%)
Glutamine (Gln, Q)
n = 8 (2.33%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 12 38 5 4 24 3 18 8 0 1 1 3 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 9 0 0 3 10 0 3 6 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 24 0 1 6 12 0 2 7 2 8 1 0 1 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 2 12 0 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 79 152 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 112 53 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 100 186 51
ND3 (size: 1033 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.79%)
Alanine (Ala, A)
n = 17 (4.96%)
Serine (Ser, S)
n = 28 (8.16%)
Threonine (Thr, T)
n = 53 (15.45%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 5 (1.46%)
Leucine (Leu, L)
n = 54 (15.74%)
Isoleucine (Ile, I)
n = 29 (8.45%)
Methionine (Met, M)
n = 41 (11.95%)
Proline (Pro, P)
n = 23 (6.71%)
Phenylalanine (Phe, F)
n = 13 (3.79%)
Tyrosine (Tyr, Y)
n = 10 (2.92%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 8 (2.33%)
Glutamine (Gln, Q)
n = 8 (2.33%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 12 38 5 4 24 3 18 8 0 1 1 3 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 9 0 0 3 10 0 3 6 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 24 0 1 6 12 0 2 7 2 8 1 0 1 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 2 12 0 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 79 152 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 112 53 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 100 186 51
ND4 (size: 1365 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.96%)
Alanine (Ala, A)
n = 33 (7.27%)
Serine (Ser, S)
n = 23 (5.07%)
Threonine (Thr, T)
n = 59 (13.0%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.98%)
Leucine (Leu, L)
n = 88 (19.38%)
Isoleucine (Ile, I)
n = 46 (10.13%)
Methionine (Met, M)
n = 33 (7.27%)
Proline (Pro, P)
n = 29 (6.39%)
Phenylalanine (Phe, F)
n = 15 (3.3%)
Tyrosine (Tyr, Y)
n = 16 (3.52%)
Tryptophan (Trp, W)
n = 10 (2.2%)
Aspartic acid (Asp, D)
n = 4 (0.88%)
Glutamic acid (Glu, E)
n = 7 (1.54%)
Asparagine (Asn, N)
n = 19 (4.19%)
Glutamine (Gln, Q)
n = 11 (2.42%)
Histidine (His, H)
n = 14 (3.08%)
Lysine (Lys, K)
n = 9 (1.98%)
Arginine (Arg, R)
n = 8 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 21 30 14 8 47 3 15 11 0 4 1 4 0 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 6 9 18 0 1 5 10 2 2 8 19 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 30 5 2 6 10 1 2 2 6 10 1 1 8 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 3 1 3 9 0 0 3 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 134 170 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 140 81 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 125 222 89
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 15 (15.31%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 11 (11.22%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 3 (3.06%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 2 (2.04%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 4 5 5 1 6 2 4 1 0 0 2 1 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 0 2 6 0 0 0 0 3 0 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 1 3 1 0 2 3 1 0 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 1 0 2 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 23 41 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 30 38 23
ND5 (size: 1791 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.53%)
Alanine (Ala, A)
n = 41 (6.88%)
Serine (Ser, S)
n = 39 (6.54%)
Threonine (Thr, T)
n = 69 (11.58%)
Cysteine (Cys, C)
n = 5 (0.84%)
Valine (Val, V)
n = 14 (2.35%)
Leucine (Leu, L)
n = 103 (17.28%)
Isoleucine (Ile, I)
n = 44 (7.38%)
Methionine (Met, M)
n = 48 (8.05%)
Proline (Pro, P)
n = 28 (4.7%)
Phenylalanine (Phe, F)
n = 28 (4.7%)
Tyrosine (Tyr, Y)
n = 14 (2.35%)
Tryptophan (Trp, W)
n = 13 (2.18%)
Aspartic acid (Asp, D)
n = 12 (2.01%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 29 (4.87%)
Glutamine (Gln, Q)
n = 20 (3.36%)
Histidine (His, H)
n = 13 (2.18%)
Lysine (Lys, K)
n = 27 (4.53%)
Arginine (Arg, R)
n = 10 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 23 42 15 9 58 4 17 19 1 5 2 7 0 13 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 6 14 19 2 3 12 10 2 1 4 22 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 31 0 1 14 17 0 2 5 5 9 1 0 9 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 1 4 8 22 5 0 2 8 0 0 1 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 157 225 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 170 127 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 183 295 95
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 7 (4.07%)
Serine (Ser, S)
n = 11 (6.4%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 4 (2.33%)
Valine (Val, V)
n = 27 (15.7%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 13 (7.56%)
Tyrosine (Tyr, Y)
n = 13 (7.56%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 4 (2.33%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 4 0 1 1 8 0 0 16 1 5 5 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 0 5 0 1 1 13 0 2 12 2 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 2 0 1 3 3 2 10 3 3 16 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 1 1 0 1 2 0 1 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 15 27 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 21 24 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 8 25 86
Total protein-coding genes (size: 11365 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.57%)
Alanine (Ala, A)
n = 263 (6.95%)
Serine (Ser, S)
n = 245 (6.47%)
Threonine (Thr, T)
n = 373 (9.85%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 172 (4.54%)
Leucine (Leu, L)
n = 610 (16.11%)
Isoleucine (Ile, I)
n = 296 (7.82%)
Methionine (Met, M)
n = 261 (6.89%)
Proline (Pro, P)
n = 217 (5.73%)
Phenylalanine (Phe, F)
n = 220 (5.81%)
Tyrosine (Tyr, Y)
n = 128 (3.38%)
Tryptophan (Trp, W)
n = 103 (2.72%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 85 (2.25%)
Asparagine (Asn, N)
n = 132 (3.49%)
Glutamine (Gln, Q)
n = 95 (2.51%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 96 (2.54%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 136 227 90 46 279 33 135 92 3 49 26 80 17 107 113
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 13 16 42 92 120 9 33 65 83 30 19 53 141 4 58
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
132 177 6 25 56 100 4 19 41 57 71 15 27 44 88 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 72 13 21 46 87 9 9 22 37 2 0 1 5 3 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
798 935 1219 835
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
474 1038 716 1559
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
210 1074 1723 780

Failed to understand id: ?term=("Phelsuma guimbeaui"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.