Viewing data for Drosophila melanogaster


Scientific name Drosophila melanogaster
Common name Fruit fly
Maximum lifespan 0.30 years (Drosophila melanogaster@AnAge)

Total mtDNA (size: 19524 bases) GC AT G C A T
Base content (bases) 3471 16053 1991 1480 7902 8151
Base content per 1 kb (bases) 178 822 102 76 405 417
Base content (%) 17.8% 82.2%
Total protein-coding genes (size: 11164 bases) GC AT G C A T
Base content (bases) 2544 8620 1430 1114 4263 4357
Base content per 1 kb (bases) 228 772 128 100 382 390
Base content (%) 22.8% 77.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1449 bases) GC AT G C A T
Base content (bases) 330 1119 183 147 549 570
Base content per 1 kb (bases) 228 772 126 101 379 393
Base content (%) 22.8% 77.2%
Total rRNA-coding genes (size: 2110 bases) GC AT G C A T
Base content (bases) 381 1729 245 136 861 868
Base content per 1 kb (bases) 181 819 116 64 408 411
Base content (%) 18.1% 81.9%
12S rRNA gene (size: 786 bases) GC AT G C A T
Base content (bases) 156 630 99 57 321 309
Base content per 1 kb (bases) 198 802 126 73 408 393
Base content (%) 19.8% 80.2%
16S rRNA gene (size: 1324 bases) GC AT G C A T
Base content (bases) 225 1099 146 79 540 559
Base content per 1 kb (bases) 170 830 110 60 408 422
Base content (%) 17.0% 83.0%

ATP6 (size: 675 bases) GC AT G C A T
Base content (bases) 162 513 94 68 295 218
Base content per 1 kb (bases) 240 760 139 101 437 323
Base content (%) 24.0% 76.0%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 27 135 20 7 71 64
Base content per 1 kb (bases) 167 833 123 43 438 395
Base content (%) 16.7% 83.3%
COX1 (size: 1536 bases) GC AT G C A T
Base content (bases) 446 1090 217 229 616 474
Base content per 1 kb (bases) 290 710 141 149 401 309
Base content (%) 29.0% 71.0%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 179 506 87 92 276 230
Base content per 1 kb (bases) 261 739 127 134 403 336
Base content (%) 26.1% 73.9%
COX3 (size: 789 bases) GC AT G C A T
Base content (bases) 231 558 119 112 303 255
Base content per 1 kb (bases) 293 707 151 142 384 323
Base content (%) 29.3% 70.7%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 295 842 155 140 478 364
Base content per 1 kb (bases) 259 741 136 123 420 320
Base content (%) 25.9% 74.1%
ND1 (size: 939 bases) GC AT G C A T
Base content (bases) 210 729 136 74 259 470
Base content per 1 kb (bases) 224 776 145 79 276 501
Base content (%) 22.4% 77.6%
ND2 (size: 1024 bases) GC AT G C A T
Base content (bases) 176 848 96 80 477 371
Base content per 1 kb (bases) 172 828 94 78 466 362
Base content (%) 17.2% 82.8%
ND3 (size: 354 bases) GC AT G C A T
Base content (bases) 69 285 40 29 165 120
Base content per 1 kb (bases) 195 805 113 82 466 339
Base content (%) 19.5% 80.5%
ND4 (size: 1339 bases) GC AT G C A T
Base content (bases) 263 1076 163 100 429 647
Base content per 1 kb (bases) 196 804 122 75 320 483
Base content (%) 19.6% 80.4%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 51 240 33 18 91 149
Base content per 1 kb (bases) 175 825 113 62 313 512
Base content (%) 17.5% 82.5%
ND5 (size: 1717 bases) GC AT G C A T
Base content (bases) 361 1356 220 141 549 807
Base content per 1 kb (bases) 210 790 128 82 320 470
Base content (%) 21.0% 79.0%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 75 450 50 25 257 193
Base content per 1 kb (bases) 143 857 95 48 490 368
Base content (%) 14.3% 85.7%

ATP6 (size: 675 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.91%)
Alanine (Ala, A)
n = 12 (5.36%)
Serine (Ser, S)
n = 22 (9.82%)
Threonine (Thr, T)
n = 18 (8.04%)
Cysteine (Cys, C)
n = 2 (0.89%)
Valine (Val, V)
n = 10 (4.46%)
Leucine (Leu, L)
n = 41 (18.3%)
Isoleucine (Ile, I)
n = 19 (8.48%)
Methionine (Met, M)
n = 14 (6.25%)
Proline (Pro, P)
n = 11 (4.91%)
Phenylalanine (Phe, F)
n = 18 (8.04%)
Tyrosine (Tyr, Y)
n = 7 (3.13%)
Tryptophan (Trp, W)
n = 5 (2.23%)
Aspartic acid (Asp, D)
n = 1 (0.45%)
Glutamic acid (Glu, E)
n = 4 (1.79%)
Asparagine (Asn, N)
n = 13 (5.8%)
Glutamine (Gln, Q)
n = 4 (1.79%)
Histidine (His, H)
n = 7 (3.13%)
Lysine (Lys, K)
n = 2 (0.89%)
Arginine (Arg, R)
n = 3 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 0 13 5 0 0 0 36 4 0 2 0 7 1 16 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 12 0 0 0 1 1 9 0 6 2 2 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 9 0 9 0 7 0 0 0 6 1 0 0 13 0 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 0 1 2 0 1 0 2 0 6 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 30 72 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 57 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 7 107 108
ATP8 (size: 162 bases)
Amino acid sequence: IPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSMNWKW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 7 (13.21%)
Threonine (Thr, T)
n = 1 (1.89%)
Cysteine (Cys, C)
n = 1 (1.89%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (11.32%)
Isoleucine (Ile, I)
n = 8 (15.09%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 4 (7.55%)
Phenylalanine (Phe, F)
n = 4 (7.55%)
Tyrosine (Tyr, Y)
n = 3 (5.66%)
Tryptophan (Trp, W)
n = 3 (5.66%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 7 (13.21%)
Glutamine (Gln, Q)
n = 1 (1.89%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.66%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 3 0 0 0 0 6 1 0 0 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 0 0 1 0 0 0 0 0 2 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 0 2 0 0 0 3 0 0 0 5 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 0 0 0 0 0 1 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 5 23 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 12 16 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
0 3 25 26
COX1 (size: 1536 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.2%)
Alanine (Ala, A)
n = 37 (7.24%)
Serine (Ser, S)
n = 40 (7.83%)
Threonine (Thr, T)
n = 33 (6.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 33 (6.46%)
Leucine (Leu, L)
n = 65 (12.72%)
Isoleucine (Ile, I)
n = 50 (9.78%)
Methionine (Met, M)
n = 23 (4.5%)
Proline (Pro, P)
n = 25 (4.89%)
Phenylalanine (Phe, F)
n = 39 (7.63%)
Tyrosine (Tyr, Y)
n = 18 (3.52%)
Tryptophan (Trp, W)
n = 15 (2.94%)
Aspartic acid (Asp, D)
n = 15 (2.94%)
Glutamic acid (Glu, E)
n = 9 (1.76%)
Asparagine (Asn, N)
n = 18 (3.52%)
Glutamine (Gln, Q)
n = 10 (1.96%)
Histidine (His, H)
n = 18 (3.52%)
Lysine (Lys, K)
n = 6 (1.17%)
Arginine (Arg, R)
n = 10 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
49 1 23 5 0 7 0 52 10 0 15 0 17 1 36 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 29 0 7 1 6 0 40 1 14 1 10 0 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 13 1 11 1 18 1 4 0 12 6 0 1 18 0 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 0 14 1 5 1 2 0 8 0 5 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 75 139 157
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 126 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 16 240 249
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 10 (4.41%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 11 (4.85%)
Phenylalanine (Phe, F)
n = 15 (6.61%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 6 (2.64%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 9 (3.96%)
Asparagine (Asn, N)
n = 17 (7.49%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 2 9 4 0 1 0 25 7 0 5 0 10 1 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 7 0 2 0 4 1 6 0 5 1 3 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 0 7 0 4 0 2 0 7 2 0 1 14 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 0 9 1 3 0 1 0 6 0 4 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 36 68 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 41 61 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 10 101 112
COX3 (size: 789 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.63%)
Alanine (Ala, A)
n = 16 (6.11%)
Serine (Ser, S)
n = 19 (7.25%)
Threonine (Thr, T)
n = 22 (8.4%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.49%)
Leucine (Leu, L)
n = 29 (11.07%)
Isoleucine (Ile, I)
n = 22 (8.4%)
Methionine (Met, M)
n = 7 (2.67%)
Proline (Pro, P)
n = 9 (3.44%)
Phenylalanine (Phe, F)
n = 25 (9.54%)
Tyrosine (Tyr, Y)
n = 12 (4.58%)
Tryptophan (Trp, W)
n = 13 (4.96%)
Aspartic acid (Asp, D)
n = 5 (1.91%)
Glutamic acid (Glu, E)
n = 7 (2.67%)
Asparagine (Asn, N)
n = 9 (3.44%)
Glutamine (Gln, Q)
n = 7 (2.67%)
Histidine (His, H)
n = 16 (6.11%)
Lysine (Lys, K)
n = 2 (0.76%)
Arginine (Arg, R)
n = 4 (1.53%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 6 2 0 2 0 25 6 1 4 1 10 2 24 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 9 1 6 0 4 0 16 0 4 1 4 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 11 0 1 0 13 0 2 0 10 2 0 0 9 0 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 0 4 1 2 0 0 0 4 0 3 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 40 67 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 61 59 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 129 112
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.61%)
Alanine (Ala, A)
n = 21 (5.56%)
Serine (Ser, S)
n = 17 (4.5%)
Threonine (Thr, T)
n = 19 (5.03%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.61%)
Leucine (Leu, L)
n = 56 (14.81%)
Isoleucine (Ile, I)
n = 43 (11.38%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 23 (6.08%)
Phenylalanine (Phe, F)
n = 31 (8.2%)
Tyrosine (Tyr, Y)
n = 18 (4.76%)
Tryptophan (Trp, W)
n = 13 (3.44%)
Aspartic acid (Asp, D)
n = 10 (2.65%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 25 (6.61%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 10 (2.65%)
Lysine (Lys, K)
n = 8 (2.12%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
40 3 11 4 0 3 0 48 8 0 9 0 16 0 25 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 0 14 3 4 0 5 0 19 1 14 0 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 8 0 4 1 8 0 1 0 13 5 0 1 23 2 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 8 2 8 0 0 0 8 0 3 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 56 111 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 76 83 167
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 23 170 183
ND1 (size: 939 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (6.09%)
Alanine (Ala, A)
n = 14 (4.49%)
Serine (Ser, S)
n = 29 (9.29%)
Threonine (Thr, T)
n = 10 (3.21%)
Cysteine (Cys, C)
n = 8 (2.56%)
Valine (Val, V)
n = 20 (6.41%)
Leucine (Leu, L)
n = 54 (17.31%)
Isoleucine (Ile, I)
n = 25 (8.01%)
Methionine (Met, M)
n = 14 (4.49%)
Proline (Pro, P)
n = 9 (2.88%)
Phenylalanine (Phe, F)
n = 39 (12.5%)
Tyrosine (Tyr, Y)
n = 19 (6.09%)
Tryptophan (Trp, W)
n = 6 (1.92%)
Aspartic acid (Asp, D)
n = 4 (1.28%)
Glutamic acid (Glu, E)
n = 10 (3.21%)
Asparagine (Asn, N)
n = 10 (3.21%)
Glutamine (Gln, Q)
n = 5 (1.6%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 10 (3.21%)
Arginine (Arg, R)
n = 7 (2.24%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 0 13 0 0 0 0 49 4 1 12 0 6 2 39 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 7 1 12 0 0 2 8 0 7 4 8 0 1 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 13 0 5 1 4 0 19 0 1 5 10 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 10 0 4 0 10 0 2 0 4 1 6 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 21 79 146
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 52 59 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 1 121 172
ND2 (size: 1024 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.82%)
Alanine (Ala, A)
n = 11 (3.24%)
Serine (Ser, S)
n = 35 (10.29%)
Threonine (Thr, T)
n = 18 (5.29%)
Cysteine (Cys, C)
n = 2 (0.59%)
Valine (Val, V)
n = 8 (2.35%)
Leucine (Leu, L)
n = 60 (17.65%)
Isoleucine (Ile, I)
n = 35 (10.29%)
Methionine (Met, M)
n = 31 (9.12%)
Proline (Pro, P)
n = 7 (2.06%)
Phenylalanine (Phe, F)
n = 38 (11.18%)
Tyrosine (Tyr, Y)
n = 12 (3.53%)
Tryptophan (Trp, W)
n = 10 (2.94%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.06%)
Asparagine (Asn, N)
n = 29 (8.53%)
Glutamine (Gln, Q)
n = 7 (2.06%)
Histidine (His, H)
n = 3 (0.88%)
Lysine (Lys, K)
n = 12 (3.53%)
Arginine (Arg, R)
n = 2 (0.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 2 31 3 0 1 0 55 7 0 5 0 3 0 37 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 0 8 1 2 0 2 0 9 2 4 1 2 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 12 0 13 2 12 1 2 0 12 0 1 1 28 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 0 1 0 11 1 0 0 2 0 5 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 23 132 146
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 64 71 172
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 9 168 158
ND3 (size: 1024 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.82%)
Alanine (Ala, A)
n = 11 (3.24%)
Serine (Ser, S)
n = 35 (10.29%)
Threonine (Thr, T)
n = 18 (5.29%)
Cysteine (Cys, C)
n = 2 (0.59%)
Valine (Val, V)
n = 8 (2.35%)
Leucine (Leu, L)
n = 60 (17.65%)
Isoleucine (Ile, I)
n = 35 (10.29%)
Methionine (Met, M)
n = 31 (9.12%)
Proline (Pro, P)
n = 7 (2.06%)
Phenylalanine (Phe, F)
n = 38 (11.18%)
Tyrosine (Tyr, Y)
n = 12 (3.53%)
Tryptophan (Trp, W)
n = 10 (2.94%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.06%)
Asparagine (Asn, N)
n = 29 (8.53%)
Glutamine (Gln, Q)
n = 7 (2.06%)
Histidine (His, H)
n = 3 (0.88%)
Lysine (Lys, K)
n = 12 (3.53%)
Arginine (Arg, R)
n = 2 (0.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 2 31 3 0 1 0 55 7 0 5 0 3 0 37 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 0 8 1 2 0 2 0 9 2 4 1 2 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 12 0 13 2 12 1 2 0 12 0 1 1 28 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 0 1 0 11 1 0 0 2 0 5 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 23 132 146
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 64 71 172
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 9 168 158
ND4 (size: 1339 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.84%)
Alanine (Ala, A)
n = 16 (3.6%)
Serine (Ser, S)
n = 48 (10.79%)
Threonine (Thr, T)
n = 10 (2.25%)
Cysteine (Cys, C)
n = 9 (2.02%)
Valine (Val, V)
n = 17 (3.82%)
Leucine (Leu, L)
n = 98 (22.02%)
Isoleucine (Ile, I)
n = 35 (7.87%)
Methionine (Met, M)
n = 33 (7.42%)
Proline (Pro, P)
n = 11 (2.47%)
Phenylalanine (Phe, F)
n = 38 (8.54%)
Tyrosine (Tyr, Y)
n = 25 (5.62%)
Tryptophan (Trp, W)
n = 13 (2.92%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 9 (2.02%)
Asparagine (Asn, N)
n = 23 (5.17%)
Glutamine (Gln, Q)
n = 6 (1.35%)
Histidine (His, H)
n = 7 (1.57%)
Lysine (Lys, K)
n = 13 (2.92%)
Arginine (Arg, R)
n = 6 (1.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 0 30 2 0 2 0 88 3 3 11 0 6 0 38 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 9 0 13 1 2 0 15 0 9 2 7 0 4 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 18 0 8 1 4 0 24 1 0 6 23 0 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 0 3 0 11 2 3 0 3 0 17 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 34 135 206
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 64 86 221
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 2 208 219
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.17%)
Alanine (Ala, A)
n = 1 (1.04%)
Serine (Ser, S)
n = 11 (11.46%)
Threonine (Thr, T)
n = 2 (2.08%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 4 (4.17%)
Leucine (Leu, L)
n = 19 (19.79%)
Isoleucine (Ile, I)
n = 9 (9.38%)
Methionine (Met, M)
n = 11 (11.46%)
Proline (Pro, P)
n = 1 (1.04%)
Phenylalanine (Phe, F)
n = 12 (12.5%)
Tyrosine (Tyr, Y)
n = 5 (5.21%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 3 (3.13%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 1 (1.04%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 1 (1.04%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 10 2 0 0 0 16 1 0 3 0 1 0 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 0 1 0 0 2 0 0 2 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 0 2 0 3 0 5 0 0 1 4 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 1 0 1 0 1 0 0 1 3 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 8 33 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 9 18 55
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 1 40 51
ND5 (size: 1717 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 35 (6.13%)
Alanine (Ala, A)
n = 24 (4.2%)
Serine (Ser, S)
n = 63 (11.03%)
Threonine (Thr, T)
n = 18 (3.15%)
Cysteine (Cys, C)
n = 9 (1.58%)
Valine (Val, V)
n = 25 (4.38%)
Leucine (Leu, L)
n = 107 (18.74%)
Isoleucine (Ile, I)
n = 50 (8.76%)
Methionine (Met, M)
n = 50 (8.76%)
Proline (Pro, P)
n = 12 (2.1%)
Phenylalanine (Phe, F)
n = 47 (8.23%)
Tyrosine (Tyr, Y)
n = 29 (5.08%)
Tryptophan (Trp, W)
n = 12 (2.1%)
Aspartic acid (Asp, D)
n = 11 (1.93%)
Glutamic acid (Glu, E)
n = 10 (1.75%)
Asparagine (Asn, N)
n = 32 (5.6%)
Glutamine (Gln, Q)
n = 10 (1.75%)
Histidine (His, H)
n = 8 (1.4%)
Lysine (Lys, K)
n = 14 (2.45%)
Arginine (Arg, R)
n = 6 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
49 1 47 5 1 0 0 93 9 1 14 0 10 1 45 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 8 1 21 0 2 1 14 0 14 7 11 0 1 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 29 0 7 0 7 0 27 2 2 8 31 1 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 1 11 0 13 1 2 0 4 0 20 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 42 191 234
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
89 90 114 279
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 9 244 293
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (2.87%)
Alanine (Ala, A)
n = 2 (1.15%)
Serine (Ser, S)
n = 18 (10.34%)
Threonine (Thr, T)
n = 13 (7.47%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 5 (2.87%)
Leucine (Leu, L)
n = 36 (20.69%)
Isoleucine (Ile, I)
n = 25 (14.37%)
Methionine (Met, M)
n = 15 (8.62%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 15 (8.62%)
Tyrosine (Tyr, Y)
n = 7 (4.02%)
Tryptophan (Trp, W)
n = 1 (0.57%)
Aspartic acid (Asp, D)
n = 2 (1.15%)
Glutamic acid (Glu, E)
n = 2 (1.15%)
Asparagine (Asn, N)
n = 12 (6.9%)
Glutamine (Gln, Q)
n = 3 (1.72%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 7 (4.02%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 0 15 1 0 3 0 32 3 0 1 0 4 0 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 1 1 0 0 0 0 5 0 2 0 1 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 0 11 1 5 0 1 0 6 1 0 0 12 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 2 0 7 0 0 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 12 73 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 35 35 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
0 3 85 87
Total protein-coding genes (size: 11173 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.88%)
Alanine (Ala, A)
n = 168 (4.51%)
Serine (Ser, S)
n = 338 (9.08%)
Threonine (Thr, T)
n = 179 (4.81%)
Cysteine (Cys, C)
n = 41 (1.1%)
Valine (Val, V)
n = 182 (4.89%)
Leucine (Leu, L)
n = 620 (16.66%)
Isoleucine (Ile, I)
n = 369 (9.91%)
Methionine (Met, M)
n = 228 (6.13%)
Proline (Pro, P)
n = 130 (3.49%)
Phenylalanine (Phe, F)
n = 332 (8.92%)
Tyrosine (Tyr, Y)
n = 166 (4.46%)
Tryptophan (Trp, W)
n = 101 (2.71%)
Aspartic acid (Asp, D)
n = 66 (1.77%)
Glutamic acid (Glu, E)
n = 78 (2.1%)
Asparagine (Asn, N)
n = 203 (5.45%)
Glutamine (Gln, Q)
n = 70 (1.88%)
Histidine (His, H)
n = 79 (2.12%)
Lysine (Lys, K)
n = 86 (2.31%)
Arginine (Arg, R)
n = 59 (1.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
353 16 215 33 1 21 0 541 64 6 82 1 91 8 317 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 39 2 129 8 27 4 61 2 137 19 79 6 42 3 95
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 77 2 128 6 96 4 30 0 145 21 4 24 193 10 72
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 76 2 59 7 81 5 13 0 44 2 74 0 8 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
713 393 1169 1448
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
524 711 757 1731
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
97 107 1691 1828

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.