Viewing data for Strongylocentrotus purpuratus


Scientific name Strongylocentrotus purpuratus
Common name Purple sea urchin
Maximum lifespan 50.00 years (Strongylocentrotus purpuratus@AnAge)

Total mtDNA (size: 15650 bases) GC AT G C A T
Base content (bases) 6420 9230 3547 2873 4732 4498
Base content per 1 kb (bases) 410 590 227 184 302 287
Base content (%) 41.0% 59.0%
Total protein-coding genes (size: 11487 bases) GC AT G C A T
Base content (bases) 4769 6718 2733 2036 3622 3096
Base content per 1 kb (bases) 415 585 238 177 315 270
Base content (%) 41.5% 58.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 611 930 302 309 436 494
Base content per 1 kb (bases) 396 604 196 201 283 321
Base content (%) 39.6% 60.4%
Total rRNA-coding genes (size: 2408 bases) GC AT G C A T
Base content (bases) 963 1445 473 490 597 848
Base content per 1 kb (bases) 400 600 196 203 248 352
Base content (%) 40.0% 60.0%
12S rRNA gene (size: 878 bases) GC AT G C A T
Base content (bases) 387 491 190 197 204 287
Base content per 1 kb (bases) 441 559 216 224 232 327
Base content (%) 44.1% 55.9%
16S rRNA gene (size: 1530 bases) GC AT G C A T
Base content (bases) 576 954 283 293 393 561
Base content per 1 kb (bases) 376 624 185 192 257 367
Base content (%) 37.6% 62.4%

ATP6 (size: 696 bases) GC AT G C A T
Base content (bases) 276 420 164 112 234 186
Base content per 1 kb (bases) 397 603 236 161 336 267
Base content (%) 39.7% 60.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 60 108 40 20 56 52
Base content per 1 kb (bases) 357 643 238 119 333 310
Base content (%) 35.7% 64.3%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 679 875 380 299 496 379
Base content per 1 kb (bases) 437 563 245 192 319 244
Base content (%) 43.7% 56.3%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 297 393 171 126 211 182
Base content per 1 kb (bases) 430 570 248 183 306 264
Base content (%) 43.0% 57.0%
COX3 (size: 783 bases) GC AT G C A T
Base content (bases) 330 453 177 153 244 209
Base content per 1 kb (bases) 421 579 226 195 312 267
Base content (%) 42.1% 57.9%
CYTB (size: 1142 bases) GC AT G C A T
Base content (bases) 493 649 293 200 355 294
Base content per 1 kb (bases) 432 568 257 175 311 257
Base content (%) 43.2% 56.8%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 390 579 214 176 340 239
Base content per 1 kb (bases) 402 598 221 182 351 247
Base content (%) 40.2% 59.8%
ND2 (size: 1059 bases) GC AT G C A T
Base content (bases) 414 645 232 182 374 271
Base content per 1 kb (bases) 391 609 219 172 353 256
Base content (%) 39.1% 60.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 156 195 86 70 113 82
Base content per 1 kb (bases) 444 556 245 199 322 234
Base content (%) 44.4% 55.6%
ND4 (size: 1389 bases) GC AT G C A T
Base content (bases) 585 804 338 247 418 386
Base content per 1 kb (bases) 421 579 243 178 301 278
Base content (%) 42.1% 57.9%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 115 179 68 47 97 82
Base content per 1 kb (bases) 391 609 231 160 330 279
Base content (%) 39.1% 60.9%
ND5 (size: 1914 bases) GC AT G C A T
Base content (bases) 786 1128 459 327 587 541
Base content per 1 kb (bases) 411 589 240 171 307 283
Base content (%) 41.1% 58.9%
ND6 (size: 498 bases) GC AT G C A T
Base content (bases) 191 307 113 78 104 203
Base content per 1 kb (bases) 384 616 227 157 209 408
Base content (%) 38.4% 61.6%

ATP6 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.76%)
Alanine (Ala, A)
n = 19 (8.23%)
Serine (Ser, S)
n = 20 (8.66%)
Threonine (Thr, T)
n = 12 (5.19%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 13 (5.63%)
Leucine (Leu, L)
n = 40 (17.32%)
Isoleucine (Ile, I)
n = 26 (11.26%)
Methionine (Met, M)
n = 7 (3.03%)
Proline (Pro, P)
n = 15 (6.49%)
Phenylalanine (Phe, F)
n = 22 (9.52%)
Tyrosine (Tyr, Y)
n = 6 (2.6%)
Tryptophan (Trp, W)
n = 7 (3.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.73%)
Asparagine (Asn, N)
n = 11 (4.76%)
Glutamine (Gln, Q)
n = 9 (3.9%)
Histidine (His, H)
n = 3 (1.3%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 3 9 10 2 15 1 6 5 4 2 5 4 2 15 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 6 4 8 1 4 4 3 0 4 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 3 4 0 1 2 3 2 4 4 6 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 0 5 0 0 0 3 1 5 2 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 59 68 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 54 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 51 84 68
ATP8 (size: 168 bases)
Amino acid sequence: VPQLEFAWWIVNFSLIWASVLIVISLLLNSFPPNSAGQSSSSLTLNKTTTNWQWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 9 (16.36%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 0 (0%)
Proline (Pro, P)
n = 3 (5.45%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (1.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 0 1 3 0 5 3 0 0 1 2 1 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 2 0 0 1 1 0 0 0 1 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 2 5 0 0 0 2 0 0 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
9 10 16 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 17 11 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 13 25 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.7%)
Alanine (Ala, A)
n = 40 (7.74%)
Serine (Ser, S)
n = 38 (7.35%)
Threonine (Thr, T)
n = 34 (6.58%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 35 (6.77%)
Leucine (Leu, L)
n = 64 (12.38%)
Isoleucine (Ile, I)
n = 44 (8.51%)
Methionine (Met, M)
n = 24 (4.64%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 46 (8.9%)
Tyrosine (Tyr, Y)
n = 16 (3.09%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 16 (3.09%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 16 (3.09%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 20 (3.87%)
Lysine (Lys, K)
n = 6 (1.16%)
Arginine (Arg, R)
n = 11 (2.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 13 10 15 11 11 3 18 8 1 12 8 10 5 21 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
24 0 0 9 16 12 3 11 4 21 9 10 6 10 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 12 10 7 1 3 1 6 10 4 6 6 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 3 6 10 6 7 6 3 1 4 3 3 1 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
145 108 132 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 132 93 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 140 154 150
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.8%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 16 (6.99%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 19 (8.3%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 13 (5.68%)
Methionine (Met, M)
n = 7 (3.06%)
Proline (Pro, P)
n = 12 (5.24%)
Phenylalanine (Phe, F)
n = 17 (7.42%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 6 (2.62%)
Aspartic acid (Asp, D)
n = 11 (4.8%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 11 (4.8%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 4 (1.75%)
Lysine (Lys, K)
n = 2 (0.87%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 4 8 5 6 0 8 5 4 8 2 4 5 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 4 1 6 1 3 1 5 2 4 5 3 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 1 4 10 1 0 0 0 4 6 0 3 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 7 4 7 2 2 0 3 3 0 2 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 50 51 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 55 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 66 69 63
COX3 (size: 783 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 14 (5.38%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 5 (1.92%)
Asparagine (Asn, N)
n = 9 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 6 4 3 8 1 10 4 3 8 2 9 1 18 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 5 7 7 2 2 8 8 2 2 4 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 2 3 4 0 1 1 6 2 5 2 3 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 3 2 3 3 0 2 3 1 7 1 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 53 65 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 61 52 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 63 92 76
CYTB (size: 1142 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 18 (4.75%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 30 (7.92%)
Leucine (Leu, L)
n = 53 (13.98%)
Isoleucine (Ile, I)
n = 35 (9.23%)
Methionine (Met, M)
n = 7 (1.85%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 37 (9.76%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 22 (5.8%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 7 (1.85%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 6 15 8 6 13 5 16 5 2 10 6 10 4 19 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 2 19 9 1 1 5 9 7 4 10 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 1 9 5 4 2 1 2 7 9 5 5 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 3 4 2 5 9 7 0 0 7 1 2 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 80 95 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 91 77 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 122 121 84
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.59%)
Alanine (Ala, A)
n = 21 (6.52%)
Serine (Ser, S)
n = 33 (10.25%)
Threonine (Thr, T)
n = 12 (3.73%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 23 (7.14%)
Leucine (Leu, L)
n = 61 (18.94%)
Isoleucine (Ile, I)
n = 26 (8.07%)
Methionine (Met, M)
n = 7 (2.17%)
Proline (Pro, P)
n = 18 (5.59%)
Phenylalanine (Phe, F)
n = 30 (9.32%)
Tyrosine (Tyr, Y)
n = 15 (4.66%)
Tryptophan (Trp, W)
n = 6 (1.86%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 12 (3.73%)
Asparagine (Asn, N)
n = 13 (4.04%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 11 8 9 17 5 12 4 2 7 1 8 7 23 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 9 5 6 1 4 5 6 3 4 6 5 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 11 8 5 1 1 1 9 6 1 10 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 6 2 2 6 7 0 0 6 1 4 2 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 71 73 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 76 59 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 67 107 92
ND2 (size: 1059 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.97%)
Alanine (Ala, A)
n = 22 (6.25%)
Serine (Ser, S)
n = 41 (11.65%)
Threonine (Thr, T)
n = 21 (5.97%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 25 (7.1%)
Leucine (Leu, L)
n = 60 (17.05%)
Isoleucine (Ile, I)
n = 41 (11.65%)
Methionine (Met, M)
n = 6 (1.7%)
Proline (Pro, P)
n = 16 (4.55%)
Phenylalanine (Phe, F)
n = 26 (7.39%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.42%)
Glutamic acid (Glu, E)
n = 4 (1.14%)
Asparagine (Asn, N)
n = 15 (4.26%)
Glutamine (Gln, Q)
n = 12 (3.41%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 7 (1.99%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 7 16 15 5 11 2 18 9 3 11 5 3 6 20 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 6 8 6 2 1 6 8 6 5 5 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 2 11 8 9 2 2 2 5 4 4 9 5 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 3 3 2 8 7 1 1 3 0 4 3 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 70 101 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 89 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 73 113 111
ND3 (size: 1059 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.97%)
Alanine (Ala, A)
n = 22 (6.25%)
Serine (Ser, S)
n = 41 (11.65%)
Threonine (Thr, T)
n = 21 (5.97%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 25 (7.1%)
Leucine (Leu, L)
n = 60 (17.05%)
Isoleucine (Ile, I)
n = 41 (11.65%)
Methionine (Met, M)
n = 6 (1.7%)
Proline (Pro, P)
n = 16 (4.55%)
Phenylalanine (Phe, F)
n = 26 (7.39%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.42%)
Glutamic acid (Glu, E)
n = 4 (1.14%)
Asparagine (Asn, N)
n = 15 (4.26%)
Glutamine (Gln, Q)
n = 12 (3.41%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 7 (1.99%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 7 16 15 5 11 2 18 9 3 11 5 3 6 20 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 6 8 6 2 1 6 8 6 5 5 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 2 11 8 9 2 2 2 5 4 4 9 5 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 3 3 2 8 7 1 1 3 0 4 3 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 70 101 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 89 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 73 113 111
ND4 (size: 1389 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.63%)
Alanine (Ala, A)
n = 44 (9.52%)
Serine (Ser, S)
n = 52 (11.26%)
Threonine (Thr, T)
n = 27 (5.84%)
Cysteine (Cys, C)
n = 6 (1.3%)
Valine (Val, V)
n = 22 (4.76%)
Leucine (Leu, L)
n = 81 (17.53%)
Isoleucine (Ile, I)
n = 57 (12.34%)
Methionine (Met, M)
n = 16 (3.46%)
Proline (Pro, P)
n = 17 (3.68%)
Phenylalanine (Phe, F)
n = 24 (5.19%)
Tyrosine (Tyr, Y)
n = 9 (1.95%)
Tryptophan (Trp, W)
n = 16 (3.46%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.95%)
Asparagine (Asn, N)
n = 19 (4.11%)
Glutamine (Gln, Q)
n = 9 (1.95%)
Histidine (His, H)
n = 8 (1.73%)
Lysine (Lys, K)
n = 7 (1.52%)
Arginine (Arg, R)
n = 9 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 8 30 18 10 26 8 13 7 2 9 2 7 4 17 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 2 4 5 23 15 1 1 5 13 7 6 6 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 10 11 15 2 3 1 1 8 6 6 4 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 4 0 4 11 7 1 0 4 4 8 2 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 105 140 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 126 66 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 107 180 105
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.22%)
Alanine (Ala, A)
n = 4 (4.12%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 5 (5.15%)
Cysteine (Cys, C)
n = 2 (2.06%)
Valine (Val, V)
n = 6 (6.19%)
Leucine (Leu, L)
n = 26 (26.8%)
Isoleucine (Ile, I)
n = 10 (10.31%)
Methionine (Met, M)
n = 3 (3.09%)
Proline (Pro, P)
n = 1 (1.03%)
Phenylalanine (Phe, F)
n = 5 (5.15%)
Tyrosine (Tyr, Y)
n = 2 (2.06%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 2 (2.06%)
Histidine (His, H)
n = 2 (2.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 3 2 5 5 8 1 4 1 1 2 2 2 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 1 1 1 0 1 4 2 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 1 4 2 0 0 1 1 1 0 3 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 5 0 1 0 1 0 1 1 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 26 28 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 17 16 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 25 38 22
ND5 (size: 1914 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 36 (5.65%)
Alanine (Ala, A)
n = 52 (8.16%)
Serine (Ser, S)
n = 91 (14.29%)
Threonine (Thr, T)
n = 43 (6.75%)
Cysteine (Cys, C)
n = 8 (1.26%)
Valine (Val, V)
n = 30 (4.71%)
Leucine (Leu, L)
n = 108 (16.95%)
Isoleucine (Ile, I)
n = 58 (9.11%)
Methionine (Met, M)
n = 15 (2.35%)
Proline (Pro, P)
n = 23 (3.61%)
Phenylalanine (Phe, F)
n = 48 (7.54%)
Tyrosine (Tyr, Y)
n = 10 (1.57%)
Tryptophan (Trp, W)
n = 9 (1.41%)
Aspartic acid (Asp, D)
n = 10 (1.57%)
Glutamic acid (Glu, E)
n = 15 (2.35%)
Asparagine (Asn, N)
n = 34 (5.34%)
Glutamine (Gln, Q)
n = 12 (1.88%)
Histidine (His, H)
n = 10 (1.57%)
Lysine (Lys, K)
n = 15 (2.35%)
Arginine (Arg, R)
n = 10 (1.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 9 28 19 17 29 9 26 9 3 11 4 12 3 29 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 4 4 13 20 16 3 4 7 19 6 7 7 6 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 5 18 15 22 4 2 9 5 5 3 8 10 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 4 4 6 14 15 0 1 8 1 14 7 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
143 129 197 169
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
95 177 107 259
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
89 153 237 159
ND6 (size: 498 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (9.09%)
Alanine (Ala, A)
n = 5 (3.03%)
Serine (Ser, S)
n = 22 (13.33%)
Threonine (Thr, T)
n = 4 (2.42%)
Cysteine (Cys, C)
n = 1 (0.61%)
Valine (Val, V)
n = 27 (16.36%)
Leucine (Leu, L)
n = 23 (13.94%)
Isoleucine (Ile, I)
n = 12 (7.27%)
Methionine (Met, M)
n = 4 (2.42%)
Proline (Pro, P)
n = 6 (3.64%)
Phenylalanine (Phe, F)
n = 18 (10.91%)
Tyrosine (Tyr, Y)
n = 7 (4.24%)
Tryptophan (Trp, W)
n = 3 (1.82%)
Aspartic acid (Asp, D)
n = 2 (1.21%)
Glutamic acid (Glu, E)
n = 4 (2.42%)
Asparagine (Asn, N)
n = 6 (3.64%)
Glutamine (Gln, Q)
n = 1 (0.61%)
Histidine (His, H)
n = 1 (0.61%)
Lysine (Lys, K)
n = 1 (0.61%)
Arginine (Arg, R)
n = 3 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 4 6 1 1 1 9 1 0 11 6 8 2 15 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 3 1 1 0 3 2 6 4 3 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 5 2 3 3 1 1 3 4 2 5 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 1 1 1 1 1 0 1 1 4 3 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 20 36 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 28 23 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 30 45 62
Total protein-coding genes (size: 11507 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 238 (6.21%)
Alanine (Ala, A)
n = 285 (7.43%)
Serine (Ser, S)
n = 388 (10.12%)
Threonine (Thr, T)
n = 224 (5.84%)
Cysteine (Cys, C)
n = 31 (0.81%)
Valine (Val, V)
n = 261 (6.81%)
Leucine (Leu, L)
n = 603 (15.73%)
Isoleucine (Ile, I)
n = 352 (9.18%)
Methionine (Met, M)
n = 106 (2.76%)
Proline (Pro, P)
n = 180 (4.69%)
Phenylalanine (Phe, F)
n = 314 (8.19%)
Tyrosine (Tyr, Y)
n = 109 (2.84%)
Tryptophan (Trp, W)
n = 106 (2.76%)
Aspartic acid (Asp, D)
n = 67 (1.75%)
Glutamic acid (Glu, E)
n = 92 (2.4%)
Asparagine (Asn, N)
n = 171 (4.46%)
Glutamine (Gln, Q)
n = 86 (2.24%)
Histidine (His, H)
n = 79 (2.06%)
Lysine (Lys, K)
n = 57 (1.49%)
Arginine (Arg, R)
n = 74 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
145 66 141 118 77 151 41 149 61 25 93 46 81 41 199 115
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
106 10 21 69 109 90 17 35 50 104 49 54 58 57 11 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
69 87 11 88 88 74 16 17 25 49 60 34 67 41 55 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
55 50 42 31 36 75 57 7 9 44 14 55 25 10 2 72
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
943 806 1032 1054
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
571 955 673 1636
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
558 939 1301 1037

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.