Viewing data for Buteo buteo


Scientific name Buteo buteo
Common name Buzzard
Maximum lifespan 28.80 years (Buteo buteo@AnAge)

Total mtDNA (size: 18674 bases) GC AT G C A T
Base content (bases) 8375 10299 5919 2456 4491 5808
Base content per 1 kb (bases) 448 552 317 132 240 311
Base content (%) 44.8% 55.2%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5356 6022 4020 1336 2649 3373
Base content per 1 kb (bases) 471 529 353 117 233 296
Base content (%) 47.1% 52.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 665 880 403 262 372 508
Base content per 1 kb (bases) 430 570 261 170 241 329
Base content (%) 43.0% 57.0%
Total rRNA-coding genes (size: 2570 bases) GC AT G C A T
Base content (bases) 1189 1381 707 482 537 844
Base content per 1 kb (bases) 463 537 275 188 209 328
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 470 502 279 191 205 297
Base content per 1 kb (bases) 484 516 287 197 211 306
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 719 879 428 291 332 547
Base content per 1 kb (bases) 450 550 268 182 208 342
Base content (%) 45.0% 55.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 307 377 245 62 171 206
Base content per 1 kb (bases) 449 551 358 91 250 301
Base content (%) 44.9% 55.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 64 9 41 54
Base content per 1 kb (bases) 435 565 381 54 244 321
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 732 819 490 242 392 427
Base content per 1 kb (bases) 472 528 316 156 253 275
Base content (%) 47.2% 52.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 310 374 217 93 155 219
Base content per 1 kb (bases) 453 547 317 136 227 320
Base content (%) 45.3% 54.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 384 400 269 115 189 211
Base content per 1 kb (bases) 490 510 343 147 241 269
Base content (%) 49.0% 51.0%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 548 595 416 132 275 320
Base content per 1 kb (bases) 479 521 364 115 241 280
Base content (%) 47.9% 52.1%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 465 513 339 126 247 266
Base content per 1 kb (bases) 475 525 347 129 253 272
Base content (%) 47.5% 52.5%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 481 560 380 101 237 323
Base content per 1 kb (bases) 462 538 365 97 228 310
Base content (%) 46.2% 53.8%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 161 190 123 38 86 104
Base content per 1 kb (bases) 459 541 350 108 245 296
Base content (%) 45.9% 54.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 646 732 513 133 318 414
Base content per 1 kb (bases) 469 531 372 97 231 300
Base content (%) 46.9% 53.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 141 156 105 36 78 78
Base content per 1 kb (bases) 475 525 354 121 263 263
Base content (%) 47.5% 52.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 855 963 657 198 401 562
Base content per 1 kb (bases) 470 530 361 109 221 309
Base content (%) 47.0% 53.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 257 262 204 53 64 198
Base content per 1 kb (bases) 495 505 393 102 123 382
Base content (%) 49.5% 50.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 64 (28.19%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 16 7 6 14 33 4 7 8 0 0 4 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 8 4 0 4 0 5 0 2 8 7 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 0 5 3 0 0 4 0 3 0 0 2 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 0 1 3 0 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 92 70 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 34 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 86 102 35
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPTPWFLIMALSWLTFTMIIQPKLLPFIPTNTPSTKPTTITHTPSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 0 3 2 0 1 1 1 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 1 6 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 1 1 0 0 0 0 0 1 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 2 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 18 24 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 9 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 21 21 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 31 24 6 18 35 0 4 7 2 7 11 14 2 12 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 10 28 9 0 6 17 21 3 6 7 18 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 16 1 3 9 10 1 0 3 5 12 0 0 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 2 13 8 1 1 1 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 126 134 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 223 199 83
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 16 10 3 7 17 2 1 7 0 2 4 6 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 7 7 0 1 3 4 0 1 5 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 1 4 5 6 0 0 2 2 6 0 0 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 12 2 3 9 3 1 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 64 61 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 61 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 93 97 30
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 7 3 12 17 1 1 8 0 3 3 6 1 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 7 13 0 2 7 8 1 2 6 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 1 10 4 0 0 4 0 10 1 0 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 1 4 2 0 0 2 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 75 56 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 69 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 125 99 30
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 25 (6.58%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 30 (7.89%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 11 (2.89%)
Leucine (Leu, L)
n = 69 (18.16%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 26 (6.84%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 7 3 22 35 3 6 7 1 1 2 8 0 2 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 14 6 0 2 10 11 2 3 13 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 8 0 1 14 6 1 0 1 1 12 0 0 2 19 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 1 5 9 1 0 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 118 104 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 195 137 40
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 28 (8.62%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 26 (8.0%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 21 (6.46%)
Methionine (Met, M)
n = 14 (4.31%)
Proline (Pro, P)
n = 23 (7.08%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.08%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 11 7 21 28 4 7 4 2 0 3 9 1 1 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 10 12 0 2 3 7 2 4 10 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 6 12 5 0 0 5 2 12 1 0 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 4 1 3 7 0 0 5 2 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 100 86 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 100 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 139 124 44
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 32 (9.25%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 52 (15.03%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 71 (20.52%)
Isoleucine (Ile, I)
n = 24 (6.94%)
Methionine (Met, M)
n = 13 (3.76%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 10 7 22 32 4 6 8 0 0 2 6 1 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 6 17 9 0 1 5 6 0 7 4 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 27 1 4 13 8 1 1 3 2 4 0 0 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 0 0 1 13 1 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 107 117 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 129 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 144 149 41
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 32 (9.25%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 52 (15.03%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 71 (20.52%)
Isoleucine (Ile, I)
n = 24 (6.94%)
Methionine (Met, M)
n = 13 (3.76%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 10 7 22 32 4 6 8 0 0 2 6 1 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 6 17 9 0 1 5 6 0 7 4 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 27 1 4 13 8 1 1 3 2 4 0 0 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 0 0 1 13 1 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 107 117 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 129 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 144 149 41
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 54 (11.79%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 114 (24.89%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 11 (2.4%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 9 (1.97%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 20 (4.37%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 30 21 9 35 60 0 9 11 1 1 2 4 0 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 6 12 13 0 2 8 5 2 3 12 10 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 16 1 5 10 10 0 2 11 2 9 0 1 2 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 9 0 1 2 9 1 1 5 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 173 146 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 136 74 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 204 194 52
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 1 3 16 0 0 2 0 1 0 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 2 5 1 0 0 3 1 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 6 3 0 1 2 2 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 2 0 1 0 0 1 1 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 32 26 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 44 35 16
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 48 (7.93%)
Threonine (Thr, T)
n = 76 (12.56%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 108 (17.85%)
Isoleucine (Ile, I)
n = 52 (8.6%)
Methionine (Met, M)
n = 29 (4.79%)
Proline (Pro, P)
n = 34 (5.62%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 23 (3.8%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 41 26 11 39 49 4 5 14 5 0 5 5 1 7 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 5 5 30 13 0 1 11 19 1 4 11 19 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 34 0 2 19 15 0 1 11 2 10 2 0 2 21 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 1 1 5 18 2 1 4 3 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 178 212 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 194 108 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 285 242 60
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 8 (4.65%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 4 (2.33%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 26 (15.12%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 6 (3.49%)
Aspartic acid (Asp, D)
n = 5 (2.91%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 4 0 1 3 7 0 0 15 2 6 12 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 2 2 2 4 5 5 0 4 20 2 0 0 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 3 0 1 2 2 0 7 0 3 11 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 5 0 0 1 1 0 1 2 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 17 18 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 28 19 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 8 27 64
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.79%)
Alanine (Ala, A)
n = 295 (7.77%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 373 (9.82%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 154 (4.06%)
Leucine (Leu, L)
n = 700 (18.44%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 159 (4.19%)
Proline (Pro, P)
n = 226 (5.95%)
Phenylalanine (Phe, F)
n = 214 (5.64%)
Tyrosine (Tyr, Y)
n = 105 (2.77%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 122 (3.21%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 118 (3.11%)
Lysine (Lys, K)
n = 83 (2.19%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
70 220 132 63 204 339 25 57 81 12 30 38 68 18 44 170
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 6 24 51 146 93 5 26 69 94 31 37 84 100 5 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
159 147 5 32 107 75 6 7 47 25 80 8 12 19 103 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
96 78 14 16 46 75 8 5 26 36 3 0 2 7 2 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
823 1138 1083 754
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
483 1114 684 1517
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
183 1619 1481 515

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.