Viewing data for Accipiter nisus


Scientific name Accipiter nisus
Common name Sparrowhawk
Maximum lifespan 20.20 years (Accipiter nisus@AnAge)

Total mtDNA (size: 18647 bases) GC AT G C A T
Base content (bases) 8025 10622 5643 2382 4778 5844
Base content per 1 kb (bases) 430 570 303 128 256 313
Base content (%) 43.0% 57.0%
Total protein-coding genes (size: 11377 bases) GC AT G C A T
Base content (bases) 5124 6253 3801 1323 2791 3462
Base content per 1 kb (bases) 450 550 334 116 245 304
Base content (%) 45.0% 55.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 656 890 395 261 382 508
Base content per 1 kb (bases) 424 576 255 169 247 329
Base content (%) 42.4% 57.6%
Total rRNA-coding genes (size: 2573 bases) GC AT G C A T
Base content (bases) 1180 1393 698 482 549 844
Base content per 1 kb (bases) 459 541 271 187 213 328
Base content (%) 45.9% 54.1%
12S rRNA gene (size: 971 bases) GC AT G C A T
Base content (bases) 465 506 275 190 199 307
Base content per 1 kb (bases) 479 521 283 196 205 316
Base content (%) 47.9% 52.1%
16S rRNA gene (size: 1602 bases) GC AT G C A T
Base content (bases) 715 887 423 292 350 537
Base content per 1 kb (bases) 446 554 264 182 218 335
Base content (%) 44.6% 55.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 306 378 247 59 169 209
Base content per 1 kb (bases) 447 553 361 86 247 306
Base content (%) 44.7% 55.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 63 9 44 52
Base content per 1 kb (bases) 429 571 375 54 262 310
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 692 859 453 239 415 444
Base content per 1 kb (bases) 446 554 292 154 268 286
Base content (%) 44.6% 55.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 205 100 167 212
Base content per 1 kb (bases) 446 554 300 146 244 310
Base content (%) 44.6% 55.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 365 419 248 117 203 216
Base content per 1 kb (bases) 466 534 316 149 259 276
Base content (%) 46.6% 53.4%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 525 619 388 137 286 333
Base content per 1 kb (bases) 459 541 339 120 250 291
Base content (%) 45.9% 54.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 429 546 319 110 252 294
Base content per 1 kb (bases) 440 560 327 113 258 302
Base content (%) 44.0% 56.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 458 583 364 94 253 330
Base content per 1 kb (bases) 440 560 350 90 243 317
Base content (%) 44.0% 56.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 159 193 120 39 90 103
Base content per 1 kb (bases) 452 548 341 111 256 293
Base content (%) 45.2% 54.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 603 775 470 133 350 425
Base content per 1 kb (bases) 438 562 341 97 254 308
Base content (%) 43.8% 56.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 102 40 74 81
Base content per 1 kb (bases) 478 522 343 135 249 273
Base content (%) 47.8% 52.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 825 993 626 199 428 565
Base content per 1 kb (bases) 454 546 344 109 235 311
Base content (%) 45.4% 54.6%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 247 272 199 48 64 208
Base content per 1 kb (bases) 476 524 383 92 123 401
Base content (%) 47.6% 52.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 11 5 17 35 3 2 9 0 2 0 3 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 6 3 0 4 2 3 0 1 8 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 1 4 2 0 0 4 0 3 0 0 0 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 2 1 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
32 95 75 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 33 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 87 101 35
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPTPWFLTMLLSWLIFALLIQPKLLPFIPTNTPSNKLTQTTPTLSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (20.0%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 0 2 2 5 0 2 3 0 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 1 0 0 0 0 2 3 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 0 0 1 2 0 0 0 0 0 0 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 21 20 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 10 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 22 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 25 24 4 14 33 1 8 10 0 8 9 17 1 12 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 16 17 12 0 6 16 23 2 5 8 17 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 0 3 6 15 0 0 3 6 11 2 0 3 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 1 6 9 9 0 0 2 6 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 120 136 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 94 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 193 214 99
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 28 (12.33%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 12 1 7 14 3 3 6 1 2 6 6 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 6 6 1 1 3 3 1 4 2 6 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 3 8 3 0 0 2 2 6 0 0 3 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 4 8 4 0 1 1 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 60 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 59 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 86 93 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 7 4 8 18 1 3 8 0 2 4 6 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 6 12 1 3 8 9 0 1 8 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 3 6 4 0 1 4 4 6 1 0 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 2 2 2 0 0 1 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 72 58 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 108 104 42
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 25 (6.58%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 12 (3.16%)
Leucine (Leu, L)
n = 68 (17.89%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 27 (7.11%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 22 (5.79%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 11 (2.89%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 23 5 8 11 43 3 3 8 0 2 1 8 1 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 4 14 7 0 2 9 13 1 1 7 19 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 3 13 6 0 0 1 3 10 4 0 1 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 0 6 10 1 0 3 4 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 121 103 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 102 80 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 165 150 53
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.01%)
Alanine (Ala, A)
n = 30 (9.26%)
Serine (Ser, S)
n = 29 (8.95%)
Threonine (Thr, T)
n = 26 (8.02%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.4%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 14 7 14 34 1 9 6 1 0 2 8 1 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 13 12 0 2 3 7 1 3 6 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 5 11 8 0 0 5 5 8 1 0 4 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 1 0 4 7 0 1 3 4 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 98 86 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 102 57 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 119 151 48
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 11 (3.18%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 15 7 19 38 1 5 6 2 1 1 6 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 10 11 10 0 2 5 4 1 8 4 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 20 0 5 11 9 0 0 5 2 6 1 0 2 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 108 120 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 127 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 129 152 59
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 11 (3.18%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 15 7 19 38 1 5 6 2 1 1 6 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 10 11 10 0 2 5 4 1 8 4 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 20 0 5 11 9 0 0 5 2 6 1 0 2 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 108 120 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 127 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 129 152 59
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 59 (12.88%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 110 (24.02%)
Isoleucine (Ile, I)
n = 33 (7.21%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 20 (4.37%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 22 21 11 26 51 4 18 11 0 1 4 4 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 7 7 14 0 5 5 6 1 5 9 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 17 1 2 8 12 3 1 9 4 8 1 0 4 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 1 2 10 0 2 5 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 161 147 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 139 77 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 170 201 76
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 3 0 3 12 2 4 2 0 1 0 1 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 1 7 2 0 0 1 1 2 0 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 4 3 0 1 2 0 2 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 30 25 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 30 17 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 42 39 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.62%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 54 (8.93%)
Threonine (Thr, T)
n = 79 (13.06%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 8 (1.32%)
Leucine (Leu, L)
n = 105 (17.36%)
Isoleucine (Ile, I)
n = 53 (8.76%)
Methionine (Met, M)
n = 32 (5.29%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 21 (3.47%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 38 27 11 36 47 3 8 18 1 0 5 3 0 11 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 5 5 28 12 1 4 10 17 3 4 8 16 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
35 30 1 5 20 15 1 0 13 4 8 0 0 7 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 2 1 5 20 0 3 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 170 218 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 195 107 230
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 261 240 87
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.12%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 4 (2.33%)
Valine (Val, V)
n = 36 (20.93%)
Leucine (Leu, L)
n = 27 (15.7%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 5 4 0 1 1 7 0 0 14 1 4 17 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 4 0 2 0 5 5 6 0 1 19 4 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 3 0 1 2 4 0 4 3 5 14 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 4 0 0 1 0 0 0 4 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 15 21 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 27 17 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
75 6 26 66
Total protein-coding genes (size: 11394 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 288 (7.59%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 379 (9.98%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 155 (4.08%)
Leucine (Leu, L)
n = 690 (18.18%)
Isoleucine (Ile, I)
n = 286 (7.53%)
Methionine (Met, M)
n = 170 (4.48%)
Proline (Pro, P)
n = 224 (5.9%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 120 (3.16%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 118 (3.11%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
90 196 146 65 164 345 25 77 91 5 33 33 67 22 71 150
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
24 11 18 62 121 96 9 36 63 88 32 38 66 115 5 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
169 143 3 36 94 82 6 7 49 35 72 15 14 29 91 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 81 10 18 42 81 3 8 20 37 6 0 1 8 1 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
813 1108 1096 780
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1109 685 1522
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
181 1435 1547 634

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.