Viewing data for Alopias superciliosus


Scientific name Alopias superciliosus
Common name Bigeye thresher
Maximum lifespan 21.00 years (Alopias superciliosus@AnAge)

Total mtDNA (size: 16719 bases) GC AT G C A T
Base content (bases) 6569 10150 4307 2262 4837 5313
Base content per 1 kb (bases) 393 607 258 135 289 318
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11402 bases) GC AT G C A T
Base content (bases) 4553 6849 3157 1396 3374 3475
Base content per 1 kb (bases) 399 601 277 122 296 305
Base content (%) 39.9% 60.1%
D-loop (size: 1062 bases) GC AT G C A T
Base content (bases) 379 683 232 147 335 348
Base content per 1 kb (bases) 357 643 218 138 315 328
Base content (%) 35.7% 64.3%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 604 946 346 258 426 520
Base content per 1 kb (bases) 390 610 223 166 275 335
Base content (%) 39.0% 61.0%
Total rRNA-coding genes (size: 2619 bases) GC AT G C A T
Base content (bases) 1007 1612 556 451 677 935
Base content per 1 kb (bases) 384 616 212 172 258 357
Base content (%) 38.4% 61.6%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 395 560 220 175 231 329
Base content per 1 kb (bases) 414 586 230 183 242 345
Base content (%) 41.4% 58.6%
16S rRNA gene (size: 1664 bases) GC AT G C A T
Base content (bases) 612 1052 336 276 446 606
Base content per 1 kb (bases) 368 632 202 166 268 364
Base content (%) 36.8% 63.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 186 75 211 212
Base content per 1 kb (bases) 382 618 272 110 308 310
Base content (%) 38.2% 61.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 53 115 41 12 51 64
Base content per 1 kb (bases) 315 685 244 71 304 381
Base content (%) 31.5% 68.5%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 634 920 376 258 491 429
Base content per 1 kb (bases) 408 592 242 166 316 276
Base content (%) 40.8% 59.2%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 265 426 166 99 204 222
Base content per 1 kb (bases) 384 616 240 143 295 321
Base content (%) 38.4% 61.6%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 328 458 207 121 233 225
Base content per 1 kb (bases) 417 583 263 154 296 286
Base content (%) 41.7% 58.3%
CYTB (size: 1145 bases) GC AT G C A T
Base content (bases) 479 666 338 141 343 323
Base content per 1 kb (bases) 418 582 295 123 300 282
Base content (%) 41.8% 58.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 382 593 272 110 296 297
Base content per 1 kb (bases) 392 608 279 113 304 305
Base content (%) 39.2% 60.8%
ND2 (size: 1043 bases) GC AT G C A T
Base content (bases) 431 612 327 104 289 323
Base content per 1 kb (bases) 413 587 314 100 277 310
Base content (%) 41.3% 58.7%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 142 207 93 49 116 91
Base content per 1 kb (bases) 407 593 266 140 332 261
Base content (%) 40.7% 59.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 538 843 376 162 420 423
Base content per 1 kb (bases) 390 610 272 117 304 306
Base content (%) 39.0% 61.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 130 167 96 34 90 77
Base content per 1 kb (bases) 438 562 323 114 303 259
Base content (%) 43.8% 56.2%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 710 1120 522 188 538 582
Base content per 1 kb (bases) 388 612 285 103 294 318
Base content (%) 38.8% 61.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 206 316 161 45 98 218
Base content per 1 kb (bases) 395 605 308 86 188 418
Base content (%) 39.5% 60.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 48 (21.15%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 18 (7.93%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 11 4 4 21 4 15 8 1 2 2 7 0 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 1 11 0 1 4 3 0 2 6 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 1 0 2 1 0 1 4 3 1 0 0 4 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 0 1 0 1 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 66 74 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 59 33 113
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 61 105 52
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPHPWFIILLFSWMIFLTILPKKVVNHTFNNNPTLKSTEKPKPEPWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 1 2 1 0 2 1 0 0 0 2 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 5 2 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 0 2 0 1 0 0 0 0 0 4 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 15 17 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 10 25 19
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 31 (6.0%)
Threonine (Thr, T)
n = 34 (6.58%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.32%)
Leucine (Leu, L)
n = 64 (12.38%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 24 (4.64%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 39 (7.54%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 20 11 14 14 1 22 6 3 14 7 19 3 24 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 10 14 19 2 11 12 18 5 4 8 16 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 21 0 9 6 12 1 0 3 11 8 0 2 5 10 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 1 10 5 8 0 2 0 7 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 106 124 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 134 209 152
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 12 (5.24%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 14 (6.11%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 8 11 5 3 5 1 12 9 0 4 6 6 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 8 5 0 2 2 5 0 2 5 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 4 3 6 0 3 0 8 2 0 0 1 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 15 1 5 7 4 0 2 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 52 59 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 60 98 67
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.36%)
Leucine (Leu, L)
n = 36 (13.79%)
Isoleucine (Ile, I)
n = 15 (5.75%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 6 7 7 9 1 12 8 0 4 1 9 0 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 13 6 0 5 4 11 1 2 2 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 1 2 6 0 3 1 7 5 0 0 2 0 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 3 2 2 0 2 0 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 66 52 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 74 117 67
CYTB (size: 1145 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 23 (6.05%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 38 (10.0%)
Methionine (Met, M)
n = 13 (3.42%)
Proline (Pro, P)
n = 20 (5.26%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 11 12 16 24 2 11 9 0 4 8 7 0 14 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 16 6 1 2 9 13 1 8 4 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 3 11 6 0 0 2 7 8 0 0 8 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 4 5 9 0 1 2 5 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 102 106 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 86 80 164
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 150 136 87
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 24 (7.41%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 27 (8.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (3.09%)
Leucine (Leu, L)
n = 68 (20.99%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 16 (4.94%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 14 14 9 28 1 16 5 0 1 4 5 0 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 7 10 0 6 4 7 1 4 6 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 5 5 8 0 0 4 8 5 0 0 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 0 3 0 7 0 1 2 3 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 91 93 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 91 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 90 146 83
ND2 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 36 (10.4%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 71 (20.52%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 16 (4.62%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 15 4 22 26 1 18 9 1 1 3 3 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 9 12 5 0 2 9 5 1 3 5 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 5 11 16 0 2 2 3 5 2 0 6 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 10 0 1 1 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 91 117 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 112 57 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 124 148 66
ND3 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 36 (10.4%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 71 (20.52%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 16 (4.62%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 15 4 22 26 1 18 9 1 1 3 3 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 9 12 5 0 2 9 5 1 3 5 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 5 11 16 0 2 2 3 5 2 0 6 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 10 0 1 1 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 91 117 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 112 57 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 124 148 66
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 35 (7.63%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 32 (6.97%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 9 (1.96%)
Leucine (Leu, L)
n = 88 (19.17%)
Isoleucine (Ile, I)
n = 52 (11.33%)
Methionine (Met, M)
n = 31 (6.75%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 21 (4.58%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 18 (3.92%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 19 26 23 15 24 4 21 12 0 1 3 4 1 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 2 7 17 10 1 3 8 8 2 6 4 16 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 3 9 9 1 2 7 5 7 0 1 9 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 4 1 10 1 1 1 8 1 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 127 153 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 115 80 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 134 190 118
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 3 4 7 10 1 1 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 3 4 0 1 3 0 0 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 3 3 5 0 0 3 1 0 0 1 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 1 1 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 30 29 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 28 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 38 32 25
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 37 (6.08%)
Serine (Ser, S)
n = 52 (8.54%)
Threonine (Thr, T)
n = 49 (8.05%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 19 (3.12%)
Leucine (Leu, L)
n = 104 (17.08%)
Isoleucine (Ile, I)
n = 60 (9.85%)
Methionine (Met, M)
n = 29 (4.76%)
Proline (Pro, P)
n = 29 (4.76%)
Phenylalanine (Phe, F)
n = 42 (6.9%)
Tyrosine (Tyr, Y)
n = 14 (2.3%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 36 (5.91%)
Glutamine (Gln, Q)
n = 23 (3.78%)
Histidine (His, H)
n = 14 (2.3%)
Lysine (Lys, K)
n = 22 (3.61%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 28 26 16 26 33 4 24 22 1 5 6 6 2 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 2 11 21 5 0 3 9 16 0 3 10 16 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 21 0 6 12 21 0 3 10 12 2 1 1 16 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 5 8 22 0 2 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 154 209 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 154 134 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 214 239 145
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 33 (19.08%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 11 (6.36%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 6 1 0 1 1 17 0 0 8 1 6 8 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 8 1 4 3 6 0 5 11 4 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 0 2 1 3 0 10 0 6 13 4 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 1 0 2 0 2 0 0 1 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 11 28 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 31 24 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 3 46 70
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.91%)
Alanine (Ala, A)
n = 281 (7.39%)
Serine (Ser, S)
n = 267 (7.02%)
Threonine (Thr, T)
n = 279 (7.33%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 177 (4.65%)
Leucine (Leu, L)
n = 665 (17.48%)
Isoleucine (Ile, I)
n = 337 (8.86%)
Methionine (Met, M)
n = 182 (4.78%)
Proline (Pro, P)
n = 206 (5.41%)
Phenylalanine (Phe, F)
n = 236 (6.2%)
Tyrosine (Tyr, Y)
n = 120 (3.15%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 152 (3.99%)
Glutamine (Gln, Q)
n = 99 (2.6%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 82 (2.16%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
188 149 150 110 128 208 22 178 93 6 44 41 77 15 123 113
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 10 14 69 115 90 7 43 66 94 22 43 55 105 3 43
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
104 125 7 45 68 96 3 19 36 77 43 9 19 67 85 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
56 91 10 38 32 80 2 16 14 37 5 0 1 7 0 111
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
854 948 1088 916
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
497 978 734 1597
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
163 1119 1542 982

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.