Viewing data for Paleosuchus palpebrosus


Scientific name Paleosuchus palpebrosus
Common name Dwarf caiman
Maximum lifespan 24.10 years (Paleosuchus palpebrosus@AnAge)

Total mtDNA (size: 14935 bases) GC AT G C A T
Base content (bases) 7109 7826 5084 2025 3242 4584
Base content per 1 kb (bases) 476 524 340 136 217 307
Base content (%) 47.6% 52.4%
Total protein-coding genes (size: 11344 bases) GC AT G C A T
Base content (bases) 5429 5915 4035 1394 2547 3368
Base content per 1 kb (bases) 479 521 356 123 225 297
Base content (%) 47.9% 52.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1349 bases) GC AT G C A T
Base content (bases) 612 737 381 231 298 439
Base content per 1 kb (bases) 454 546 282 171 221 325
Base content (%) 45.4% 54.6%
Total rRNA-coding genes (size: 2089 bases) GC AT G C A T
Base content (bases) 981 1108 591 390 385 723
Base content per 1 kb (bases) 470 530 283 187 184 346
Base content (%) 47.0% 53.0%
12S rRNA gene (size: 502 bases) GC AT G C A T
Base content (bases) 247 255 140 107 93 162
Base content per 1 kb (bases) 492 508 279 213 185 323
Base content (%) 49.2% 50.8%
16S rRNA gene (size: 1587 bases) GC AT G C A T
Base content (bases) 734 853 451 283 292 561
Base content per 1 kb (bases) 463 537 284 178 184 353
Base content (%) 46.3% 53.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 249 60 153 222
Base content per 1 kb (bases) 452 548 364 88 224 325
Base content (%) 45.2% 54.8%
ATP8 (size: 169 bases) GC AT G C A T
Base content (bases) 82 87 67 15 28 59
Base content per 1 kb (bases) 485 515 396 89 166 349
Base content (%) 48.5% 51.5%
COX1 (size: 1564 bases) GC AT G C A T
Base content (bases) 735 829 500 235 378 451
Base content per 1 kb (bases) 470 530 320 150 242 288
Base content (%) 47.0% 53.0%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 321 367 232 89 152 215
Base content per 1 kb (bases) 467 533 337 129 221 313
Base content (%) 46.7% 53.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 391 393 280 111 187 206
Base content per 1 kb (bases) 499 501 357 142 239 263
Base content (%) 49.9% 50.1%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 571 566 418 153 267 299
Base content per 1 kb (bases) 502 498 368 135 235 263
Base content (%) 50.2% 49.8%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 479 487 348 131 233 254
Base content per 1 kb (bases) 496 504 360 136 241 263
Base content (%) 49.6% 50.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 486 558 364 122 249 309
Base content per 1 kb (bases) 466 534 349 117 239 296
Base content (%) 46.6% 53.4%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 155 193 110 45 96 97
Base content per 1 kb (bases) 445 555 316 129 276 279
Base content (%) 44.5% 55.5%
ND4 (size: 1371 bases) GC AT G C A T
Base content (bases) 669 702 500 169 298 404
Base content per 1 kb (bases) 488 512 365 123 217 295
Base content (%) 48.8% 51.2%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 148 146 119 29 75 71
Base content per 1 kb (bases) 503 497 405 99 255 241
Base content (%) 50.3% 49.7%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 832 974 638 194 390 584
Base content per 1 kb (bases) 461 539 353 107 216 323
Base content (%) 46.1% 53.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 262 260 216 46 49 211
Base content per 1 kb (bases) 502 498 414 88 94 404
Base content (%) 50.2% 49.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 30 (13.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 3 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 13 7 3 18 28 3 5 10 0 1 3 3 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 7 4 0 1 3 3 0 0 7 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 0 0 7 1 0 0 2 0 3 0 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 2 2 0 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 87 80 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 68 40 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 94 102 21
ATP8 (size: 169 bases)
Amino acid sequence: MPQLNPEPWLTVLLTTWIFFIAILQPKIATLTATNNPTPHKPQTTKTWHWPWTQTY
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 12 (21.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 0 1 1 4 0 0 1 3 0 1 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 3 0 0 0 0 0 0 1 3 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 5 0 0 0 0 0 0 0 1 0 1 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 0 3 0 0 0 0 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 23 8
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 14 14
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 24 22 5
COX1 (size: 1564 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.27%)
Alanine (Ala, A)
n = 36 (6.92%)
Serine (Ser, S)
n = 31 (5.96%)
Threonine (Thr, T)
n = 48 (9.23%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 35 (6.73%)
Leucine (Leu, L)
n = 59 (11.35%)
Isoleucine (Ile, I)
n = 39 (7.5%)
Methionine (Met, M)
n = 29 (5.58%)
Proline (Pro, P)
n = 33 (6.35%)
Phenylalanine (Phe, F)
n = 45 (8.65%)
Tyrosine (Tyr, Y)
n = 17 (3.27%)
Tryptophan (Trp, W)
n = 17 (3.27%)
Aspartic acid (Asp, D)
n = 15 (2.88%)
Glutamic acid (Glu, E)
n = 9 (1.73%)
Asparagine (Asn, N)
n = 20 (3.85%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 18 (3.46%)
Lysine (Lys, K)
n = 9 (1.73%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 30 25 6 13 30 4 6 7 1 4 15 15 1 14 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 21 11 1 1 9 26 7 3 13 16 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 25 0 6 14 6 1 1 3 1 16 1 0 2 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 7 2 0 15 9 0 0 1 7 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 120 149 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 144 96 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 236 206 56
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 21 (9.21%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 17 (7.46%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 12 3 10 8 5 4 7 1 1 5 6 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 5 6 0 1 3 4 0 1 5 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 2 9 5 0 0 2 1 8 1 0 0 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 2 9 3 0 0 3 1 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 64 66 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 63 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 106 86 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 15 (5.77%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 9 8 4 13 13 1 1 7 0 1 5 8 0 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 1 13 5 0 0 9 9 0 1 9 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 2 4 6 0 0 5 2 10 1 1 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 5 2 1 3 2 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 76 58 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 133 94 27
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.35%)
Alanine (Ala, A)
n = 27 (7.14%)
Serine (Ser, S)
n = 28 (7.41%)
Threonine (Thr, T)
n = 32 (8.47%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.7%)
Leucine (Leu, L)
n = 66 (17.46%)
Isoleucine (Ile, I)
n = 27 (7.14%)
Methionine (Met, M)
n = 14 (3.7%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 31 (8.2%)
Tyrosine (Tyr, Y)
n = 11 (2.91%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.12%)
Glutamic acid (Glu, E)
n = 6 (1.59%)
Asparagine (Asn, N)
n = 14 (3.7%)
Glutamine (Gln, Q)
n = 9 (2.38%)
Histidine (His, H)
n = 13 (3.44%)
Lysine (Lys, K)
n = 9 (2.38%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 20 10 4 26 27 7 2 8 1 1 5 6 2 8 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 19 5 0 1 6 12 5 2 10 12 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 1 2 15 9 0 1 1 2 9 2 0 0 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 1 1 7 7 2 0 3 3 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 119 98 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 110 71 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 189 130 32
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.36%)
Alanine (Ala, A)
n = 29 (9.03%)
Serine (Ser, S)
n = 22 (6.85%)
Threonine (Thr, T)
n = 31 (9.66%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.05%)
Leucine (Leu, L)
n = 68 (21.18%)
Isoleucine (Ile, I)
n = 21 (6.54%)
Methionine (Met, M)
n = 13 (4.05%)
Proline (Pro, P)
n = 26 (8.1%)
Phenylalanine (Phe, F)
n = 18 (5.61%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 5 (1.56%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 7 (2.18%)
Glutamine (Gln, Q)
n = 6 (1.87%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 11 10 7 23 23 7 7 6 0 3 7 3 0 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 0 18 11 0 0 6 3 5 2 12 11 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 2 1 8 9 0 0 4 3 7 3 1 1 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 2 2 3 7 0 0 2 5 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 103 83 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 104 50 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 141 121 35
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.59%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 35 (10.09%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 16 (4.61%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 25 (7.2%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 16 9 19 20 5 8 5 2 3 7 4 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 2 15 15 0 0 3 4 2 2 11 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 0 2 21 8 0 0 4 1 8 2 1 1 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 1 0 0 11 4 0 2 3 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 89 122 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 123 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 152 132 36
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.59%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 35 (10.09%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 16 (4.61%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 25 (7.2%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 16 9 19 20 5 8 5 2 3 7 4 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 2 15 15 0 0 3 4 2 2 11 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 0 2 21 8 0 0 4 1 8 2 1 1 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 1 0 0 11 4 0 2 3 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 89 122 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 123 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 152 132 36
ND4 (size: 1371 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.73%)
Alanine (Ala, A)
n = 38 (8.33%)
Serine (Ser, S)
n = 32 (7.02%)
Threonine (Thr, T)
n = 64 (14.04%)
Cysteine (Cys, C)
n = 5 (1.1%)
Valine (Val, V)
n = 16 (3.51%)
Leucine (Leu, L)
n = 91 (19.96%)
Isoleucine (Ile, I)
n = 27 (5.92%)
Methionine (Met, M)
n = 28 (6.14%)
Proline (Pro, P)
n = 30 (6.58%)
Phenylalanine (Phe, F)
n = 15 (3.29%)
Tyrosine (Tyr, Y)
n = 11 (2.41%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 6 (1.32%)
Glutamic acid (Glu, E)
n = 6 (1.32%)
Asparagine (Asn, N)
n = 18 (3.95%)
Glutamine (Gln, Q)
n = 15 (3.29%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 7 (1.54%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 18 21 6 28 40 12 4 14 1 5 2 9 0 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 3 24 9 2 1 6 8 2 1 16 13 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 22 4 1 12 8 2 2 7 5 6 2 1 6 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 1 5 5 2 1 0 8 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 150 153 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 155 74 177
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 195 177 50
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 11 (11.34%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 4 (4.12%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 2 (2.06%)
Proline (Pro, P)
n = 3 (3.09%)
Phenylalanine (Phe, F)
n = 5 (5.15%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 6 (6.19%)
Glutamine (Gln, Q)
n = 2 (2.06%)
Histidine (His, H)
n = 5 (5.15%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 1 (1.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 5 10 5 1 1 2 0 0 2 0 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 0 6 2 0 0 3 0 1 0 3 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 0 3 3 5 0 0 0 0 0 0 1 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 0 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 32 27 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 33 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 54 27 13
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (3.33%)
Alanine (Ala, A)
n = 54 (8.99%)
Serine (Ser, S)
n = 48 (7.99%)
Threonine (Thr, T)
n = 78 (12.98%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 13 (2.16%)
Leucine (Leu, L)
n = 96 (15.97%)
Isoleucine (Ile, I)
n = 51 (8.49%)
Methionine (Met, M)
n = 29 (4.83%)
Proline (Pro, P)
n = 35 (5.82%)
Phenylalanine (Phe, F)
n = 35 (5.82%)
Tyrosine (Tyr, Y)
n = 12 (2.0%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 11 (1.83%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 26 (4.33%)
Glutamine (Gln, Q)
n = 13 (2.16%)
Histidine (His, H)
n = 20 (3.33%)
Lysine (Lys, K)
n = 30 (4.99%)
Arginine (Arg, R)
n = 7 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 35 25 7 34 40 6 8 12 1 1 2 8 2 5 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 4 25 23 2 0 6 11 3 2 13 18 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
44 24 4 4 15 12 2 2 13 4 8 1 1 7 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 0 2 9 29 1 1 1 5 0 0 1 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 162 230 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 200 121 224
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 276 233 63
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.34%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 10 (5.78%)
Valine (Val, V)
n = 31 (17.92%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 2 (1.16%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 0 5 1 0 2 2 0 0 10 1 3 17 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 9 1 5 1 0 4 10 0 1 19 0 1 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 2 0 2 0 2 3 2 0 7 17 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 1 0 1 1 0 0 1 1 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 15 24 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 21 14 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
82 10 11 71
Total protein-coding genes (size: 11377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 199 (5.25%)
Alanine (Ala, A)
n = 289 (7.63%)
Serine (Ser, S)
n = 269 (7.1%)
Threonine (Thr, T)
n = 405 (10.69%)
Cysteine (Cys, C)
n = 35 (0.92%)
Valine (Val, V)
n = 175 (4.62%)
Leucine (Leu, L)
n = 641 (16.91%)
Isoleucine (Ile, I)
n = 271 (7.15%)
Methionine (Met, M)
n = 188 (4.96%)
Proline (Pro, P)
n = 236 (6.23%)
Phenylalanine (Phe, F)
n = 225 (5.94%)
Tyrosine (Tyr, Y)
n = 99 (2.61%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 84 (2.22%)
Asparagine (Asn, N)
n = 134 (3.54%)
Glutamine (Gln, Q)
n = 89 (2.35%)
Histidine (His, H)
n = 115 (3.03%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 62 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
88 183 140 63 202 245 55 51 79 10 30 55 65 25 64 161
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 13 22 25 160 95 9 16 56 82 45 16 105 108 7 34
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
192 165 14 26 111 74 6 8 44 22 77 21 25 20 114 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
104 71 13 12 57 81 12 3 14 40 5 2 1 4 2 83
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 1067 1146 762
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
455 1147 689 1500
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
298 1657 1385 451

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.