Viewing data for Vicugna vicugna


Scientific name Vicugna vicugna
Common name Vicugna
Maximum lifespan 31.60 years (Vicugna vicugna@AnAge)

Total mtDNA (size: 16084 bases) GC AT G C A T
Base content (bases) 6519 9565 4149 2370 4489 5076
Base content per 1 kb (bases) 405 595 258 147 279 316
Base content (%) 40.5% 59.5%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4593 6746 3084 1509 3282 3464
Base content per 1 kb (bases) 405 595 272 133 289 305
Base content (%) 40.5% 59.5%
D-loop (size: 650 bases) GC AT G C A T
Base content (bases) 293 357 176 117 179 178
Base content per 1 kb (bases) 451 549 271 180 275 274
Base content (%) 45.1% 54.9%
Total tRNA-coding genes (size: 1501 bases) GC AT G C A T
Base content (bases) 585 916 325 260 404 512
Base content per 1 kb (bases) 390 610 217 173 269 341
Base content (%) 39.0% 61.0%
Total rRNA-coding genes (size: 2534 bases) GC AT G C A T
Base content (bases) 1021 1513 549 472 610 903
Base content per 1 kb (bases) 403 597 217 186 241 356
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 968 bases) GC AT G C A T
Base content (bases) 411 557 226 185 218 339
Base content per 1 kb (bases) 425 575 233 191 225 350
Base content (%) 42.5% 57.5%
16S rRNA gene (size: 1566 bases) GC AT G C A T
Base content (bases) 610 956 323 287 392 564
Base content per 1 kb (bases) 390 610 206 183 250 360
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 276 405 185 91 206 199
Base content per 1 kb (bases) 405 595 272 134 302 292
Base content (%) 40.5% 59.5%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 72 132 55 17 56 76
Base content per 1 kb (bases) 353 647 270 83 275 373
Base content (%) 35.3% 64.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 662 883 386 276 464 419
Base content per 1 kb (bases) 428 572 250 179 300 271
Base content (%) 42.8% 57.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 158 111 202 213
Base content per 1 kb (bases) 393 607 231 162 295 311
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 344 440 219 125 240 200
Base content per 1 kb (bases) 439 561 279 159 306 255
Base content (%) 43.9% 56.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 477 663 316 161 325 338
Base content per 1 kb (bases) 418 582 277 141 285 296
Base content (%) 41.8% 58.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 398 558 273 125 283 275
Base content per 1 kb (bases) 416 584 286 131 296 288
Base content (%) 41.6% 58.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 376 666 275 101 295 371
Base content per 1 kb (bases) 361 639 264 97 283 356
Base content (%) 36.1% 63.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 132 215 92 40 113 102
Base content per 1 kb (bases) 380 620 265 115 326 294
Base content (%) 38.0% 62.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 557 821 392 165 389 432
Base content per 1 kb (bases) 404 596 284 120 282 313
Base content (%) 40.4% 59.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 113 184 75 38 96 88
Base content per 1 kb (bases) 380 620 253 128 323 296
Base content (%) 38.0% 62.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 745 1076 522 223 513 563
Base content per 1 kb (bases) 409 591 287 122 282 309
Base content (%) 40.9% 59.1%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 192 336 150 42 123 213
Base content per 1 kb (bases) 364 636 284 80 233 403
Base content (%) 36.4% 63.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 11 6 5 18 3 9 5 2 7 2 3 3 10 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 8 3 1 0 3 5 3 4 4 5 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 2 4 1 3 0 3 1 1 1 2 0 5 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 0 2 3 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 65 79 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 56 83 67
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILSMLMTLFILFQLKLSKHIYYSTPEPKFSKTHNQNTPWETKWTKIYLPLLLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.46%)
Threonine (Thr, T)
n = 9 (13.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.42%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 2 1 2 2 3 4 1 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 4 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 4 1 0 3 0 1 0 2 1 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 20 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 22 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 16 28 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.34%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 41 (7.98%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 19 3 5 28 8 15 5 2 12 8 16 2 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 0 9 15 16 0 8 12 21 7 5 11 10 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 3 7 9 11 0 1 2 10 9 4 2 9 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 3 10 6 8 1 2 3 3 0 0 0 0 1 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 104 136 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 149 187 132
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 7 4 1 14 4 8 5 1 5 5 5 2 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 2 2 4 2 0 2 2 3 1 5 1 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 1 6 2 5 0 2 3 9 2 1 0 4 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 8 6 5 5 0 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 55 66 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 60 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 49 87 66
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 25 (9.62%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 2 6 4 4 15 4 8 6 1 5 6 3 2 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 8 6 2 0 1 7 8 3 8 2 1 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 6 5 4 2 1 7 4 8 1 0 5 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 2 1 2 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 68 58 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 65 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 86 87 71
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 44 (11.61%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 18 7 5 5 33 3 10 5 1 2 4 8 3 9 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 5 8 12 1 5 6 13 2 1 11 9 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 17 0 4 8 9 1 0 2 6 9 1 1 5 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 2 9 9 0 2 1 5 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 95 109 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 75 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 126 154 78
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 31 (9.78%)
Serine (Ser, S)
n = 18 (5.68%)
Threonine (Thr, T)
n = 25 (7.89%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 17 (5.36%)
Leucine (Leu, L)
n = 52 (16.4%)
Isoleucine (Ile, I)
n = 25 (7.89%)
Methionine (Met, M)
n = 21 (6.62%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 20 7 8 29 1 5 4 3 3 5 9 0 15 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 11 12 8 0 3 5 4 1 4 10 5 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 2 6 6 4 1 0 1 5 6 0 2 5 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 2 2 7 0 0 1 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 86 91 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 92 127 82
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 40 6 8 22 5 10 10 1 4 3 6 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 7 6 1 1 5 9 1 7 5 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 16 0 7 7 11 1 1 4 2 9 0 0 5 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 78 146 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 99 58 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 98 167 68
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 40 6 8 22 5 10 10 1 4 3 6 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 7 6 1 1 5 9 1 7 5 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 16 0 7 7 11 1 1 4 2 9 0 0 5 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 78 146 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 99 58 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 98 167 68
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 20 (4.37%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 30 9 15 45 11 13 10 1 5 6 3 2 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 7 9 14 2 0 9 6 2 4 14 3 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 0 4 13 11 0 3 10 11 9 1 0 12 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 2 1 3 9 2 0 3 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 131 157 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 117 86 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 144 189 95
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 14 (14.29%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 11 3 3 13 2 1 2 0 0 0 4 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 1 2 4 1 2 2 0 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 4 3 1 0 1 1 2 2 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 27 31 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 22 16 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 26 41 24
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.29%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 44 (7.26%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 24 (3.96%)
Leucine (Leu, L)
n = 95 (15.68%)
Isoleucine (Ile, I)
n = 59 (9.74%)
Methionine (Met, M)
n = 35 (5.78%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 30 (4.95%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 26 (4.29%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 31 28 17 19 38 6 11 17 2 0 7 15 2 24 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 4 5 21 16 1 3 8 8 7 6 14 8 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 22 4 7 11 15 1 3 7 4 14 1 4 8 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 3 3 9 19 7 1 4 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 147 214 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 159 129 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 216 220 126
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 5 (2.86%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 15 (8.57%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 12 (6.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 2 7 0 0 1 0 10 1 0 9 0 7 8 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 3 1 0 1 8 1 4 12 1 0 0 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 2 6 0 0 1 6 0 7 3 3 4 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 3 1 0 4 0 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 6 52 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 31 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 11 40 78
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 253 (6.66%)
Serine (Ser, S)
n = 277 (7.29%)
Threonine (Thr, T)
n = 313 (8.24%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 205 (5.4%)
Leucine (Leu, L)
n = 593 (15.61%)
Isoleucine (Ile, I)
n = 321 (8.45%)
Methionine (Met, M)
n = 254 (6.69%)
Proline (Pro, P)
n = 196 (5.16%)
Phenylalanine (Phe, F)
n = 234 (6.16%)
Tyrosine (Tyr, Y)
n = 140 (3.69%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 147 (3.87%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
182 139 192 70 82 267 51 109 77 15 53 46 80 26 126 108
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
62 8 16 60 97 88 8 33 61 83 39 49 79 58 10 74
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
85 135 19 62 67 79 7 24 38 65 75 14 14 65 82 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 69 27 30 41 83 15 5 18 40 2 1 0 6 1 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
841 916 1196 847
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
472 977 744 1607
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
310 1097 1457 936

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.