Viewing data for Anguilla marmorata


Scientific name Anguilla marmorata
Common name Marbled eel
Maximum lifespan 40.00 years (Anguilla marmorata@AnAge)

Total mtDNA (size: 16745 bases) GC AT G C A T
Base content (bases) 6885 9860 4342 2543 4115 5745
Base content per 1 kb (bases) 411 589 259 152 246 343
Base content (%) 41.1% 58.9%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4704 6743 3115 1589 2930 3813
Base content per 1 kb (bases) 411 589 272 139 256 333
Base content (%) 41.1% 58.9%
D-loop (size: 1020 bases) GC AT G C A T
Base content (bases) 323 697 195 128 292 405
Base content per 1 kb (bases) 317 683 191 125 286 397
Base content (%) 31.7% 68.3%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 666 896 378 288 385 511
Base content per 1 kb (bases) 426 574 242 184 246 327
Base content (%) 42.6% 57.4%
Total rRNA-coding genes (size: 2657 bases) GC AT G C A T
Base content (bases) 1164 1493 641 523 496 997
Base content per 1 kb (bases) 438 562 241 197 187 375
Base content (%) 43.8% 56.2%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 437 512 242 195 183 329
Base content per 1 kb (bases) 460 540 255 205 193 347
Base content (%) 46.0% 54.0%
16S rRNA gene (size: 1708 bases) GC AT G C A T
Base content (bases) 727 981 399 328 313 668
Base content per 1 kb (bases) 426 574 234 192 183 391
Base content (%) 42.6% 57.4%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 263 420 180 83 198 222
Base content per 1 kb (bases) 385 615 264 122 290 325
Base content (%) 38.5% 61.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 66 102 45 21 42 60
Base content per 1 kb (bases) 393 607 268 125 250 357
Base content (%) 39.3% 60.7%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 675 918 396 279 457 461
Base content per 1 kb (bases) 424 576 249 175 287 289
Base content (%) 42.4% 57.6%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 289 402 177 112 173 229
Base content per 1 kb (bases) 418 582 256 162 250 331
Base content (%) 41.8% 58.2%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 340 445 213 127 209 236
Base content per 1 kb (bases) 433 567 271 162 266 301
Base content (%) 43.3% 56.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 478 662 320 158 310 352
Base content per 1 kb (bases) 419 581 281 139 272 309
Base content (%) 41.9% 58.1%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 417 555 284 133 241 314
Base content per 1 kb (bases) 429 571 292 137 248 323
Base content (%) 42.9% 57.1%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 409 636 286 123 231 405
Base content per 1 kb (bases) 391 609 274 118 221 388
Base content (%) 39.1% 60.9%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 146 203 98 48 103 100
Base content per 1 kb (bases) 418 582 281 138 295 287
Base content (%) 41.8% 58.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 561 820 375 186 356 464
Base content per 1 kb (bases) 406 594 272 135 258 336
Base content (%) 40.6% 59.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 97 40 80 80
Base content per 1 kb (bases) 461 539 327 135 269 269
Base content (%) 46.1% 53.9%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 721 1121 492 229 464 657
Base content per 1 kb (bases) 391 609 267 124 252 357
Base content (%) 39.1% 60.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 206 316 154 52 73 243
Base content per 1 kb (bases) 395 605 295 100 140 466
Base content (%) 39.5% 60.5%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (7.96%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 11 7 5 25 3 9 9 0 4 3 10 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 4 7 0 2 2 7 0 3 1 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 16 0 2 2 1 0 1 3 1 2 0 1 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 74 69 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 30 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 47 122 50
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVLSWAVFLAILPTKVMAHTFNNEPNLQTAKKPKMDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 1 1 1 1 2 1 1 0 0 3 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 1 2 0 0 0 0 0 0 3 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 1 0 1 0 0 0 1 0 1 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 14 18 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 13 26 11
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 47 (8.87%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.11%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 9 (1.7%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 11 (2.08%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 16 16 10 8 25 5 14 9 0 8 9 23 3 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 12 18 15 2 11 5 26 6 5 2 20 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 0 4 6 12 1 1 3 8 11 0 0 5 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 14 0 6 11 10 1 4 0 5 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
169 116 130 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 138 104 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 142 227 133
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 8 4 1 13 2 7 8 1 4 3 13 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 5 13 0 1 1 7 0 2 4 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 2 7 0 0 3 3 6 0 0 1 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 1 12 3 0 0 1 4 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 59 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 64 114 41
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 9 2 3 18 2 4 9 0 5 3 8 1 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 11 8 0 2 6 11 2 1 2 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 0 2 8 0 0 3 8 4 2 0 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 0 1 4 3 0 0 1 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 66 57 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 79 123 49
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 13 11 5 33 1 8 6 0 4 4 18 2 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 13 8 1 5 3 15 3 1 0 21 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 2 8 14 0 0 0 3 13 0 1 4 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 0 2 10 8 1 0 1 7 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 98 90 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 81 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 129 181 60
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 33 (10.22%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 24 (7.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (5.26%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 22 (6.81%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 13 13 8 8 30 3 10 4 1 1 3 13 0 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 18 12 0 0 5 11 2 3 2 16 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 0 4 11 1 0 2 4 8 0 1 4 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 0 0 3 8 0 2 0 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 89 88 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 97 60 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 98 166 46
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 30 5 5 34 6 8 13 1 0 1 8 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 10 13 1 2 2 16 0 1 3 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 32 2 2 1 11 0 1 2 2 6 0 0 5 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 3 12 1 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 95 134 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 78 212 42
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 30 5 5 34 6 8 13 1 0 1 8 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 10 13 1 2 2 16 0 1 3 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 32 2 2 1 11 0 1 2 2 6 0 0 5 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 3 12 1 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 95 134 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 78 212 42
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 25 26 13 8 47 3 15 10 1 2 3 8 3 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 2 15 17 0 4 5 19 1 3 2 19 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 1 5 4 14 0 2 4 5 10 2 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 1 4 12 1 1 2 9 0 0 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 128 143 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 121 78 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 126 243 73
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 7 2 3 10 1 3 2 0 0 0 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 7 4 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 4 4 0 0 2 0 1 1 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 0 1 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 27 22 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 38 42 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 52 (8.48%)
Serine (Ser, S)
n = 35 (5.71%)
Threonine (Thr, T)
n = 55 (8.97%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 28 (4.57%)
Leucine (Leu, L)
n = 87 (14.19%)
Isoleucine (Ile, I)
n = 52 (8.48%)
Methionine (Met, M)
n = 40 (6.53%)
Proline (Pro, P)
n = 31 (5.06%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 29 32 9 10 51 3 14 22 0 8 5 14 1 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 7 22 21 2 4 7 19 1 2 3 25 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 36 1 5 4 13 2 1 10 2 10 1 0 5 29 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 12 0 5 8 25 1 0 0 8 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
136 148 218 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 162 133 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 182 306 104
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 18 (10.4%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 1 7 0 1 1 8 0 0 9 1 2 6 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 5 0 13 0 3 0 10 0 3 12 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 3 1 3 0 13 0 2 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 4 1 0 0 4 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 19 21 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 3 27 102
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 248 (6.49%)
Alanine (Ala, A)
n = 319 (8.35%)
Serine (Ser, S)
n = 218 (5.71%)
Threonine (Thr, T)
n = 304 (7.96%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 224 (5.87%)
Leucine (Leu, L)
n = 594 (15.55%)
Isoleucine (Ile, I)
n = 285 (7.46%)
Methionine (Met, M)
n = 214 (5.6%)
Proline (Pro, P)
n = 215 (5.63%)
Phenylalanine (Phe, F)
n = 230 (6.02%)
Tyrosine (Tyr, Y)
n = 123 (3.22%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 84 (2.2%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 131 (3.43%)
Glutamine (Gln, Q)
n = 101 (2.64%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
144 141 169 83 61 300 32 102 95 6 45 36 125 18 100 130
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 11 19 62 125 126 6 41 40 140 27 26 23 156 10 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
85 170 5 29 39 104 5 9 32 51 72 9 16 35 96 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 96 7 22 62 88 5 13 6 54 4 0 1 5 1 112
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
978 968 1069 805
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1015 740 1547
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
197 1032 1842 749

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.