Viewing data for Alosa pseudoharengus


Scientific name Alosa pseudoharengus
Common name Alewife
Maximum lifespan 8.00 years (Alosa pseudoharengus@AnAge)

Total mtDNA (size: 16646 bases) GC AT G C A T
Base content (bases) 7736 8910 4758 2978 4186 4724
Base content per 1 kb (bases) 465 535 286 179 251 284
Base content (%) 46.5% 53.5%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 5296 6107 3414 1882 3010 3097
Base content per 1 kb (bases) 464 536 299 165 264 272
Base content (%) 46.4% 53.6%
D-loop (size: 992 bases) GC AT G C A T
Base content (bases) 367 625 215 152 292 333
Base content per 1 kb (bases) 370 630 217 153 294 336
Base content (%) 37.0% 63.0%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 740 811 406 334 366 445
Base content per 1 kb (bases) 477 523 262 215 236 287
Base content (%) 47.7% 52.3%
Total rRNA-coding genes (size: 2636 bases) GC AT G C A T
Base content (bases) 1296 1340 703 593 508 832
Base content per 1 kb (bases) 492 508 267 225 193 316
Base content (%) 49.2% 50.8%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 482 470 263 219 194 276
Base content per 1 kb (bases) 506 494 276 230 204 290
Base content (%) 50.6% 49.4%
16S rRNA gene (size: 1684 bases) GC AT G C A T
Base content (bases) 814 870 440 374 314 556
Base content per 1 kb (bases) 483 517 261 222 186 330
Base content (%) 48.3% 51.7%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 303 380 210 93 196 184
Base content per 1 kb (bases) 444 556 307 136 287 269
Base content (%) 44.4% 55.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 48 22 46 52
Base content per 1 kb (bases) 417 583 286 131 274 310
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 728 823 415 313 436 387
Base content per 1 kb (bases) 469 531 268 202 281 250
Base content (%) 46.9% 53.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 308 383 185 123 186 197
Base content per 1 kb (bases) 446 554 268 178 269 285
Base content (%) 44.6% 55.4%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 376 409 238 138 205 204
Base content per 1 kb (bases) 479 521 303 176 261 260
Base content (%) 47.9% 52.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 524 617 336 188 314 303
Base content per 1 kb (bases) 459 541 294 165 275 266
Base content (%) 45.9% 54.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 466 509 298 168 271 238
Base content per 1 kb (bases) 478 522 306 172 278 244
Base content (%) 47.8% 52.2%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 522 523 369 153 247 276
Base content per 1 kb (bases) 500 500 353 146 236 264
Base content (%) 50.0% 50.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 156 193 99 57 103 90
Base content per 1 kb (bases) 447 553 284 163 295 258
Base content (%) 44.7% 55.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 633 748 402 231 372 376
Base content per 1 kb (bases) 458 542 291 167 269 272
Base content (%) 45.8% 54.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 93 49 82 73
Base content per 1 kb (bases) 478 522 313 165 276 246
Base content (%) 47.8% 52.2%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 834 1002 560 274 479 523
Base content per 1 kb (bases) 454 546 305 149 261 285
Base content (%) 45.4% 54.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 238 284 163 75 80 204
Base content per 1 kb (bases) 456 544 312 144 153 391
Base content (%) 45.6% 54.4%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 7 (3.1%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 1 14 10 14 3 8 8 1 3 5 6 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 3 8 7 1 2 4 5 0 5 6 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 1 3 0 0 0 0 4 1 4 0 1 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 0 0 6 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 77 67 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 32 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 70 84 56
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLIFLTVIPPKVLAHNFNNEPTTVGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 0 1 0 3 0 0 1 0 0 3 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 1 1 0 0 0 1 0 4 3 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 1 0 0 0 0 0 0 1 0 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 15 15 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 15 22 16
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 18 3 20 9 21 5 7 6 2 7 6 22 7 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 0 1 6 21 17 3 6 7 14 19 5 8 10 5 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 6 3 7 15 1 1 4 6 12 1 1 8 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 3 6 9 9 0 1 0 6 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 118 126 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 161 167 113
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 22 (9.61%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 17 (7.42%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 3 4 9 4 12 3 1 7 1 8 1 10 3 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 1 2 6 6 2 2 1 5 1 4 4 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 3 7 4 0 0 3 2 7 0 1 2 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 1 13 4 0 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 66 49 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 66 84 58
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 3 7 4 13 7 2 8 0 3 3 10 2 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 1 13 7 0 2 7 11 2 2 4 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 2 2 7 0 0 3 2 10 0 1 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 1 1 4 2 0 2 0 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 73 49 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 69 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 96 100 46
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 35 (9.23%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 14 4 10 7 21 4 13 5 0 7 7 13 1 5 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 2 19 14 0 1 10 12 5 4 7 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 7 3 11 1 0 2 1 14 0 1 2 15 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 3 4 3 8 8 1 2 0 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 88 87 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 98 76 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 150 140 65
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.17%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.86%)
Leucine (Leu, L)
n = 58 (17.9%)
Isoleucine (Ile, I)
n = 21 (6.48%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 24 (7.41%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 9 (2.78%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 10 6 12 10 20 11 4 5 1 4 3 7 5 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 18 12 1 2 1 10 7 8 8 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 0 3 9 7 0 1 3 4 7 1 1 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 2 1 3 5 2 0 0 5 3 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 96 72 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 98 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 104 112 70
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 44 (12.68%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 15 (4.32%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 9 14 13 19 10 9 9 5 4 2 3 3 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 4 27 12 1 1 5 7 4 6 11 3 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 14 3 5 9 4 0 1 5 1 9 0 1 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 0 7 1 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 101 108 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 131 53 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 137 115 62
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 44 (12.68%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 15 (4.32%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 9 14 13 19 10 9 9 5 4 2 3 3 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 4 27 12 1 1 5 7 4 6 11 3 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 14 3 5 9 4 0 1 5 1 9 0 1 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 0 7 1 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 101 108 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 131 53 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 137 115 62
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 38 (8.28%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 23 (5.01%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 36 (7.84%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 17 17 18 21 10 17 10 1 6 7 6 4 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 4 1 1 18 16 3 4 8 10 7 7 9 10 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 18 3 6 6 7 0 2 7 6 9 7 2 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 0 4 9 1 1 2 6 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 125 135 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 127 73 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 150 168 90
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 2 4 6 9 2 3 3 0 0 0 2 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 4 3 5 1 1 3 1 0 0 1 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 4 0 1 0 1 3 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 0 0 3 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 33 22 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 31 37 22
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.4%)
Alanine (Ala, A)
n = 65 (10.64%)
Serine (Ser, S)
n = 43 (7.04%)
Threonine (Thr, T)
n = 58 (9.49%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.75%)
Leucine (Leu, L)
n = 86 (14.08%)
Isoleucine (Ile, I)
n = 51 (8.35%)
Methionine (Met, M)
n = 31 (5.07%)
Proline (Pro, P)
n = 32 (5.24%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 14 (2.29%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 26 (4.26%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 12 (1.96%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 24 19 20 12 30 12 11 16 4 8 6 12 3 12 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 3 3 7 40 16 2 4 10 16 3 13 14 5 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 25 4 7 11 12 1 3 9 4 8 1 1 7 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 4 10 17 3 0 1 8 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 148 198 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 186 115 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 226 210 128
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 15 (8.67%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 4 0 3 1 14 0 0 11 2 4 7 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 3 1 8 3 6 4 5 1 3 12 2 0 0 3 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 1 2 2 3 2 6 2 1 6 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 2 3 1 1 0 1 0 0 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 19 20 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 38 21 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 18 39 66
Total protein-coding genes (size: 11424 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 248 (6.52%)
Alanine (Ala, A)
n = 366 (9.62%)
Serine (Ser, S)
n = 244 (6.41%)
Threonine (Thr, T)
n = 302 (7.94%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 244 (6.41%)
Leucine (Leu, L)
n = 612 (16.09%)
Isoleucine (Ile, I)
n = 261 (6.86%)
Methionine (Met, M)
n = 165 (4.34%)
Proline (Pro, P)
n = 221 (5.81%)
Phenylalanine (Phe, F)
n = 234 (6.15%)
Tyrosine (Tyr, Y)
n = 118 (3.1%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 78 (2.05%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 111 (2.92%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 120 71 136 96 198 71 94 80 16 63 47 98 36 86 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
94 17 13 45 181 122 18 31 58 98 61 61 80 67 13 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
110 120 18 50 56 74 6 13 45 34 84 12 17 38 73 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 75 23 20 58 67 8 8 5 50 12 0 0 4 2 108
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1034 994 972 805
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
531 1075 683 1516
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
407 1259 1326 813

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.