Viewing data for Anguilla mossambica


Scientific name Anguilla mossambica
Common name African longfin eel
Maximum lifespan 20.00 years (Anguilla mossambica@AnAge)

Total mtDNA (size: 16694 bases) GC AT G C A T
Base content (bases) 6840 9854 4274 2566 4175 5679
Base content per 1 kb (bases) 410 590 256 154 250 340
Base content (%) 41.0% 59.0%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4707 6740 3088 1619 2964 3776
Base content per 1 kb (bases) 411 589 270 141 259 330
Base content (%) 41.1% 58.9%
D-loop (size: 971 bases) GC AT G C A T
Base content (bases) 285 686 175 110 297 389
Base content per 1 kb (bases) 294 706 180 113 306 401
Base content (%) 29.4% 70.6%
Total tRNA-coding genes (size: 1564 bases) GC AT G C A T
Base content (bases) 667 897 373 294 391 506
Base content per 1 kb (bases) 426 574 238 188 250 324
Base content (%) 42.6% 57.4%
Total rRNA-coding genes (size: 2660 bases) GC AT G C A T
Base content (bases) 1154 1506 625 529 513 993
Base content per 1 kb (bases) 434 566 235 199 193 373
Base content (%) 43.4% 56.6%
12S rRNA gene (size: 950 bases) GC AT G C A T
Base content (bases) 437 513 235 202 193 320
Base content per 1 kb (bases) 460 540 247 213 203 337
Base content (%) 46.0% 54.0%
16S rRNA gene (size: 1710 bases) GC AT G C A T
Base content (bases) 717 993 390 327 320 673
Base content per 1 kb (bases) 419 581 228 191 187 394
Base content (%) 41.9% 58.1%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 273 410 185 88 195 215
Base content per 1 kb (bases) 400 600 271 129 286 315
Base content (%) 40.0% 60.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 67 101 46 21 40 61
Base content per 1 kb (bases) 399 601 274 125 238 363
Base content (%) 39.9% 60.1%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 680 913 401 279 455 458
Base content per 1 kb (bases) 427 573 252 175 286 288
Base content (%) 42.7% 57.3%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 286 405 171 115 175 230
Base content per 1 kb (bases) 414 586 247 166 253 333
Base content (%) 41.4% 58.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 333 452 205 128 217 235
Base content per 1 kb (bases) 424 576 261 163 276 299
Base content (%) 42.4% 57.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 474 666 314 160 317 349
Base content per 1 kb (bases) 416 584 275 140 278 306
Base content (%) 41.6% 58.4%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 418 554 285 133 237 317
Base content per 1 kb (bases) 430 570 293 137 244 326
Base content (%) 43.0% 57.0%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 413 632 282 131 236 396
Base content per 1 kb (bases) 395 605 270 125 226 379
Base content (%) 39.5% 60.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 146 203 97 49 110 93
Base content per 1 kb (bases) 418 582 278 140 315 266
Base content (%) 41.8% 58.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 563 818 373 190 360 458
Base content per 1 kb (bases) 408 592 270 138 261 332
Base content (%) 40.8% 59.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 129 168 87 42 85 83
Base content per 1 kb (bases) 434 566 293 141 286 279
Base content (%) 43.4% 56.6%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 723 1119 491 232 469 650
Base content per 1 kb (bases) 393 607 267 126 255 353
Base content (%) 39.3% 60.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 206 316 153 53 75 241
Base content per 1 kb (bases) 395 605 293 102 144 462
Base content (%) 39.5% 60.5%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (8.41%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 15 (6.64%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 9 8 6 19 7 12 8 1 5 2 12 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 3 8 0 1 2 5 2 2 2 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 0 2 2 0 0 1 4 3 2 0 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 74 66 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 32 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 52 116 46
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAVLPTKVMAHTFNNEPNLQTAKKPKLDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 1 (1.82%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 1 0 1 2 0 3 2 0 1 0 2 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 0 2 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 1 0 1 0 0 0 0 1 1 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 13 16 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 15 29 7
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 46 (8.68%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 16 (3.02%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 15 (2.83%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 12 (2.26%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 17 11 6 29 3 12 7 1 8 8 24 4 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 9 20 14 3 11 9 22 6 5 5 19 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 22 0 6 5 11 1 1 3 6 13 0 1 5 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 3 7 9 12 0 5 0 4 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
168 116 132 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 137 104 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 148 222 131
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 10 4 1 12 2 6 7 2 4 3 13 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 0 5 13 1 1 1 5 2 2 2 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 2 1 8 0 0 3 6 3 0 2 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 0 2 11 3 0 0 1 4 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 58 52 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 59 115 42
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 7 3 1 19 2 4 9 0 5 3 9 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 10 8 0 4 5 10 2 2 0 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 2 1 1 9 0 0 3 8 4 2 0 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 2 3 3 0 1 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 66 56 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 71 123 56
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 26 (6.86%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 13 10 10 8 29 2 12 6 0 3 5 17 4 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 4 12 10 0 1 6 17 2 0 0 22 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 5 7 12 0 0 0 6 10 0 0 5 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 4 8 9 0 1 0 7 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 97 88 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 92 81 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 125 180 63
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 33 (10.22%)
Serine (Ser, S)
n = 19 (5.88%)
Threonine (Thr, T)
n = 21 (6.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (5.26%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 24 (7.43%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 13 8 7 33 2 8 5 0 2 3 11 1 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 20 11 1 0 6 10 2 2 4 17 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 0 2 15 0 0 2 4 8 0 2 3 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 0 0 3 7 1 1 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 90 87 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 95 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 100 170 40
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 28 7 2 34 4 9 13 1 1 2 8 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 11 13 1 0 3 15 1 2 2 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 4 1 2 13 0 1 2 1 7 0 1 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 0 2 13 0 0 0 2 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 92 131 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 113 60 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 77 205 43
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 28 7 2 34 4 9 13 1 1 2 8 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 11 13 1 0 3 15 1 2 2 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 4 1 2 13 0 1 2 1 7 0 1 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 0 2 13 0 0 0 2 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 92 131 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 113 60 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 77 205 43
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 23 24 6 13 40 7 17 11 0 1 4 11 0 10 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 1 17 16 0 3 7 19 0 0 5 19 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 0 3 6 14 0 2 3 9 6 5 3 3 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 1 4 13 0 1 1 8 1 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 123 143 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 120 80 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 130 235 71
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 2 3 7 2 5 2 0 0 0 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 2 7 4 0 0 3 1 0 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 3 5 0 0 2 0 1 1 1 0 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 0 1 1 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 25 22 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 30 45 17
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 49 (7.99%)
Serine (Ser, S)
n = 36 (5.87%)
Threonine (Thr, T)
n = 56 (9.14%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 30 (4.89%)
Leucine (Leu, L)
n = 89 (14.52%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 39 (6.36%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 38 (6.2%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 14 (2.28%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 26 34 7 15 46 6 14 21 1 10 3 16 1 13 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 4 2 7 20 22 0 4 8 18 1 2 6 22 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 33 4 4 5 15 1 1 10 3 9 2 1 9 25 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 3 10 25 1 0 0 8 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 149 219 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 160 134 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 182 297 109
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 12 (6.94%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 2 7 0 0 0 9 0 0 9 0 5 5 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 5 0 11 1 4 0 9 2 3 11 3 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 1 2 4 0 11 1 3 12 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 3 1 0 0 4 0 1 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 17 22 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 30 24 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 6 29 99
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.44%)
Alanine (Ala, A)
n = 314 (8.22%)
Serine (Ser, S)
n = 223 (5.84%)
Threonine (Thr, T)
n = 299 (7.83%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 235 (6.15%)
Leucine (Leu, L)
n = 599 (15.68%)
Isoleucine (Ile, I)
n = 280 (7.33%)
Methionine (Met, M)
n = 209 (5.47%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 228 (5.97%)
Tyrosine (Tyr, Y)
n = 125 (3.27%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 81 (2.12%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 134 (3.51%)
Glutamine (Gln, Q)
n = 100 (2.62%)
Histidine (His, H)
n = 101 (2.64%)
Lysine (Lys, K)
n = 94 (2.46%)
Arginine (Arg, R)
n = 76 (1.99%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
147 133 163 78 67 280 40 111 93 7 51 34 132 18 100 128
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 15 15 51 129 128 6 35 52 130 29 22 30 159 3 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
75 164 11 31 38 108 4 10 32 58 67 15 23 36 98 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 92 12 22 59 92 2 15 3 51 7 0 1 5 1 106
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
980 956 1059 825
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
516 1008 745 1551
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
225 1026 1814 755

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.