Viewing data for Chamaeleo dilepis


Scientific name Chamaeleo dilepis
Common name Flap-necked chameleon
Maximum lifespan 4.00 years (Chamaeleo dilepis@AnAge)

Total mtDNA (size: 17875 bases) GC AT G C A T
Base content (bases) 6639 11234 4478 2161 4723 6511
Base content per 1 kb (bases) 371 628 251 121 264 364
Base content (%) 37.1% 62.8%
Total protein-coding genes (size: 11276 bases) GC AT G C A T
Base content (bases) 4117 7159 2901 1216 3035 4124
Base content per 1 kb (bases) 365 635 257 108 269 366
Base content (%) 36.5% 63.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1493 bases) GC AT G C A T
Base content (bases) 603 890 352 251 382 508
Base content per 1 kb (bases) 404 596 236 168 256 340
Base content (%) 40.4% 59.6%
Total rRNA-coding genes (size: 2439 bases) GC AT G C A T
Base content (bases) 1025 1414 604 421 505 909
Base content per 1 kb (bases) 420 580 248 173 207 373
Base content (%) 42.0% 58.0%
12S rRNA gene (size: 922 bases) GC AT G C A T
Base content (bases) 400 522 231 169 190 332
Base content per 1 kb (bases) 434 566 251 183 206 360
Base content (%) 43.4% 56.6%
16S rRNA gene (size: 1517 bases) GC AT G C A T
Base content (bases) 625 892 373 252 315 577
Base content per 1 kb (bases) 412 588 246 166 208 380
Base content (%) 41.2% 58.8%

ATP6 (size: 675 bases) GC AT G C A T
Base content (bases) 246 429 184 62 180 249
Base content per 1 kb (bases) 364 636 273 92 267 369
Base content (%) 36.4% 63.6%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 48 114 36 12 39 75
Base content per 1 kb (bases) 296 704 222 74 241 463
Base content (%) 29.6% 70.4%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 582 966 359 223 461 505
Base content per 1 kb (bases) 376 624 232 144 298 326
Base content (%) 37.6% 62.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 245 439 161 84 189 250
Base content per 1 kb (bases) 358 642 235 123 276 365
Base content (%) 35.8% 64.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 295 489 188 107 230 259
Base content per 1 kb (bases) 376 624 240 136 293 330
Base content (%) 37.6% 62.4%
CYTB (size: 1134 bases) GC AT G C A T
Base content (bases) 433 701 307 126 324 377
Base content per 1 kb (bases) 382 618 271 111 286 332
Base content (%) 38.2% 61.8%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 354 609 249 105 258 351
Base content per 1 kb (bases) 368 632 259 109 268 364
Base content (%) 36.8% 63.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 358 681 269 89 276 405
Base content per 1 kb (bases) 345 655 259 86 266 390
Base content (%) 34.5% 65.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 125 224 92 33 104 120
Base content per 1 kb (bases) 358 642 264 95 298 344
Base content (%) 35.8% 64.2%
ND4 (size: 1353 bases) GC AT G C A T
Base content (bases) 501 852 358 143 355 497
Base content per 1 kb (bases) 370 630 265 106 262 367
Base content (%) 37.0% 63.0%
ND4L (size: 288 bases) GC AT G C A T
Base content (bases) 99 189 69 30 79 110
Base content per 1 kb (bases) 344 656 240 104 274 382
Base content (%) 34.4% 65.6%
ND5 (size: 1803 bases) GC AT G C A T
Base content (bases) 645 1158 478 167 468 690
Base content per 1 kb (bases) 358 642 265 93 260 383
Base content (%) 35.8% 64.2%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 189 324 152 37 78 246
Base content per 1 kb (bases) 368 632 296 72 152 480
Base content (%) 36.8% 63.2%

ATP6 (size: 675 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.68%)
Alanine (Ala, A)
n = 17 (7.59%)
Serine (Ser, S)
n = 11 (4.91%)
Threonine (Thr, T)
n = 31 (13.84%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.57%)
Leucine (Leu, L)
n = 45 (20.09%)
Isoleucine (Ile, I)
n = 21 (9.38%)
Methionine (Met, M)
n = 18 (8.04%)
Proline (Pro, P)
n = 12 (5.36%)
Phenylalanine (Phe, F)
n = 11 (4.91%)
Tyrosine (Tyr, Y)
n = 5 (2.23%)
Tryptophan (Trp, W)
n = 2 (0.89%)
Aspartic acid (Asp, D)
n = 1 (0.45%)
Glutamic acid (Glu, E)
n = 6 (2.68%)
Asparagine (Asn, N)
n = 6 (2.68%)
Glutamine (Gln, Q)
n = 8 (3.57%)
Histidine (His, H)
n = 5 (2.23%)
Lysine (Lys, K)
n = 6 (2.68%)
Arginine (Arg, R)
n = 5 (2.23%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 10 15 8 2 26 1 8 8 0 3 0 5 0 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 7 6 0 0 1 4 1 1 3 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 21 0 1 0 5 0 0 5 1 4 0 0 3 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 1 1 0 6 0 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 67 87 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 66 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 51 124 44
ATP8 (size: 162 bases)
Amino acid sequence: LPQLNPTPWLLMMLMAWMVINIMLNLIKEMNLIKTPLTTKMDTKTKTPWTWPW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 8 (15.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 9 (16.98%)
Isoleucine (Ile, I)
n = 4 (7.55%)
Methionine (Met, M)
n = 7 (13.21%)
Proline (Pro, P)
n = 6 (11.32%)
Phenylalanine (Phe, F)
n = 0 (0%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.43%)
Aspartic acid (Asp, D)
n = 1 (1.89%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 4 (7.55%)
Glutamine (Gln, Q)
n = 1 (1.89%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.43%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 7 1 0 4 1 2 1 0 1 0 0 0 0 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 0 1 0 0 0 0 0 1 0 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 0 0 0 0 0 0 0 0 0 1 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 1 4 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 13 28 9
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 15 13 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 8 34 9
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.35%)
Alanine (Ala, A)
n = 40 (7.77%)
Serine (Ser, S)
n = 34 (6.6%)
Threonine (Thr, T)
n = 39 (7.57%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 24 (4.66%)
Leucine (Leu, L)
n = 68 (13.2%)
Isoleucine (Ile, I)
n = 42 (8.16%)
Methionine (Met, M)
n = 38 (7.38%)
Proline (Pro, P)
n = 29 (5.63%)
Phenylalanine (Phe, F)
n = 36 (6.99%)
Tyrosine (Tyr, Y)
n = 17 (3.3%)
Tryptophan (Trp, W)
n = 16 (3.11%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 6 (1.17%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 14 (2.72%)
Arginine (Arg, R)
n = 10 (1.94%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 13 35 17 6 24 2 19 5 1 4 4 15 1 25 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 8 9 23 0 4 5 28 6 6 3 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 20 0 0 4 23 1 1 5 10 7 0 0 9 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 4 2 6 9 14 0 3 0 7 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
128 112 158 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 111 253 135
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 11 2 2 17 1 9 8 0 2 2 6 0 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 4 2 6 0 0 2 5 1 1 0 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 3 2 9 0 1 1 2 7 0 0 5 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 0 4 7 5 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 57 66 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 57 65 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 47 119 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 16 (6.15%)
Proline (Pro, P)
n = 9 (3.46%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 5 (1.92%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 7 (2.69%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 14 5 2 16 0 9 6 1 6 3 5 0 15 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 1 6 9 0 2 3 11 3 3 2 4 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 1 1 3 9 0 2 2 4 7 0 0 2 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 4 7 0 0 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 57 76 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 65 57 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 66 126 62
CYTB (size: 1134 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.57%)
Alanine (Ala, A)
n = 24 (6.37%)
Serine (Ser, S)
n = 26 (6.9%)
Threonine (Thr, T)
n = 40 (10.61%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 13 (3.45%)
Leucine (Leu, L)
n = 57 (15.12%)
Isoleucine (Ile, I)
n = 35 (9.28%)
Methionine (Met, M)
n = 21 (5.57%)
Proline (Pro, P)
n = 23 (6.1%)
Phenylalanine (Phe, F)
n = 24 (6.37%)
Tyrosine (Tyr, Y)
n = 12 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.65%)
Aspartic acid (Asp, D)
n = 5 (1.33%)
Glutamic acid (Glu, E)
n = 6 (1.59%)
Asparagine (Asn, N)
n = 22 (5.84%)
Glutamine (Gln, Q)
n = 7 (1.86%)
Histidine (His, H)
n = 12 (3.18%)
Lysine (Lys, K)
n = 9 (2.39%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 19 9 3 25 3 17 6 1 2 2 8 1 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 6 9 9 0 2 9 9 1 5 2 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 24 1 6 5 13 0 1 1 5 7 2 0 6 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 1 4 7 2 1 0 7 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 90 129 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 111 74 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 106 174 84
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.69%)
Alanine (Ala, A)
n = 16 (5.0%)
Serine (Ser, S)
n = 17 (5.31%)
Threonine (Thr, T)
n = 42 (13.13%)
Cysteine (Cys, C)
n = 3 (0.94%)
Valine (Val, V)
n = 12 (3.75%)
Leucine (Leu, L)
n = 58 (18.13%)
Isoleucine (Ile, I)
n = 23 (7.19%)
Methionine (Met, M)
n = 26 (8.13%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 14 (4.38%)
Tyrosine (Tyr, Y)
n = 13 (4.06%)
Tryptophan (Trp, W)
n = 7 (2.19%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 13 (4.06%)
Glutamine (Gln, Q)
n = 12 (3.75%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 9 (2.81%)
Arginine (Arg, R)
n = 8 (2.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 25 10 6 29 1 12 11 1 2 4 6 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 5 9 0 1 4 9 1 3 1 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 2 2 2 9 2 1 1 4 9 0 0 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 2 0 3 8 1 1 0 7 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 84 115 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 91 62 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 74 174 60
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 19 (5.51%)
Serine (Ser, S)
n = 25 (7.25%)
Threonine (Thr, T)
n = 55 (15.94%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 46 (13.33%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 40 (11.59%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 9 (2.61%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 34 7 5 21 2 9 13 0 2 2 4 1 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 11 4 0 1 2 10 0 1 3 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 31 0 4 3 14 0 1 3 4 5 0 2 5 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 12 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 73 164 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 113 59 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 83 182 70
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 19 (5.51%)
Serine (Ser, S)
n = 25 (7.25%)
Threonine (Thr, T)
n = 55 (15.94%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 46 (13.33%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 40 (11.59%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 9 (2.61%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 34 7 5 21 2 9 13 0 2 2 4 1 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 11 4 0 1 2 10 0 1 3 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 31 0 4 3 14 0 1 3 4 5 0 2 5 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 12 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 73 164 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 113 59 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 83 182 70
ND4 (size: 1353 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.56%)
Alanine (Ala, A)
n = 30 (6.67%)
Serine (Ser, S)
n = 28 (6.22%)
Threonine (Thr, T)
n = 57 (12.67%)
Cysteine (Cys, C)
n = 5 (1.11%)
Valine (Val, V)
n = 12 (2.67%)
Leucine (Leu, L)
n = 77 (17.11%)
Isoleucine (Ile, I)
n = 40 (8.89%)
Methionine (Met, M)
n = 50 (11.11%)
Proline (Pro, P)
n = 26 (5.78%)
Phenylalanine (Phe, F)
n = 12 (2.67%)
Tyrosine (Tyr, Y)
n = 14 (3.11%)
Tryptophan (Trp, W)
n = 8 (1.78%)
Aspartic acid (Asp, D)
n = 4 (0.89%)
Glutamic acid (Glu, E)
n = 6 (1.33%)
Asparagine (Asn, N)
n = 14 (3.11%)
Glutamine (Gln, Q)
n = 16 (3.56%)
Histidine (His, H)
n = 11 (2.44%)
Lysine (Lys, K)
n = 16 (3.56%)
Arginine (Arg, R)
n = 8 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 12 39 10 5 45 3 13 14 2 4 0 7 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 2 3 9 9 12 0 1 4 7 4 2 5 18 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 32 2 7 3 8 3 0 7 3 11 2 1 4 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 3 1 15 1 0 0 8 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 124 184 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 134 82 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 100 231 89
ND4L (size: 288 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.21%)
Alanine (Ala, A)
n = 5 (5.26%)
Serine (Ser, S)
n = 4 (4.21%)
Threonine (Thr, T)
n = 16 (16.84%)
Cysteine (Cys, C)
n = 3 (3.16%)
Valine (Val, V)
n = 3 (3.16%)
Leucine (Leu, L)
n = 19 (20.0%)
Isoleucine (Ile, I)
n = 8 (8.42%)
Methionine (Met, M)
n = 10 (10.53%)
Proline (Pro, P)
n = 2 (2.11%)
Phenylalanine (Phe, F)
n = 3 (3.16%)
Tyrosine (Tyr, Y)
n = 1 (1.05%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.05%)
Glutamic acid (Glu, E)
n = 2 (2.11%)
Asparagine (Asn, N)
n = 6 (6.32%)
Glutamine (Gln, Q)
n = 1 (1.05%)
Histidine (His, H)
n = 3 (3.16%)
Lysine (Lys, K)
n = 3 (3.16%)
Arginine (Arg, R)
n = 1 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 3 9 3 2 9 1 4 1 0 2 0 0 1 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 0 3 1 1 0 2 1 1 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 0 0 0 2 0 0 2 1 0 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 3 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 22 45 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 25 18 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 22 47 22
ND5 (size: 1803 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (3.5%)
Alanine (Ala, A)
n = 43 (7.17%)
Serine (Ser, S)
n = 51 (8.5%)
Threonine (Thr, T)
n = 79 (13.17%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 83 (13.83%)
Isoleucine (Ile, I)
n = 53 (8.83%)
Methionine (Met, M)
n = 55 (9.17%)
Proline (Pro, P)
n = 21 (3.5%)
Phenylalanine (Phe, F)
n = 23 (3.83%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 8 (1.33%)
Asparagine (Asn, N)
n = 34 (5.67%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 11 (1.83%)
Lysine (Lys, K)
n = 31 (5.17%)
Arginine (Arg, R)
n = 7 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 20 49 10 9 45 1 17 20 0 2 3 8 2 14 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 2 7 18 16 2 2 6 10 3 2 2 17 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 36 0 9 11 23 0 3 5 5 12 1 1 10 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 0 3 7 31 0 0 1 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 124 260 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 186 132 229
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 168 298 119
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.94%)
Alanine (Ala, A)
n = 9 (5.29%)
Serine (Ser, S)
n = 16 (9.41%)
Threonine (Thr, T)
n = 3 (1.76%)
Cysteine (Cys, C)
n = 5 (2.94%)
Valine (Val, V)
n = 24 (14.12%)
Leucine (Leu, L)
n = 29 (17.06%)
Isoleucine (Ile, I)
n = 9 (5.29%)
Methionine (Met, M)
n = 8 (4.71%)
Proline (Pro, P)
n = 3 (1.76%)
Phenylalanine (Phe, F)
n = 17 (10.0%)
Tyrosine (Tyr, Y)
n = 8 (4.71%)
Tryptophan (Trp, W)
n = 6 (3.53%)
Aspartic acid (Asp, D)
n = 5 (2.94%)
Glutamic acid (Glu, E)
n = 2 (1.18%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 3 2 0 0 1 10 0 0 10 0 7 7 16 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 5 0 7 0 1 1 10 0 2 10 1 0 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 0 3 0 6 1 7 1 4 16 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 5 0 0 0 1 0 0 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 8 29 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 24 18 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 5 31 87
Total protein-coding genes (size: 11295 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 192 (5.1%)
Alanine (Ala, A)
n = 239 (6.35%)
Serine (Ser, S)
n = 249 (6.62%)
Threonine (Thr, T)
n = 428 (11.37%)
Cysteine (Cys, C)
n = 32 (0.85%)
Valine (Val, V)
n = 146 (3.88%)
Leucine (Leu, L)
n = 580 (15.41%)
Isoleucine (Ile, I)
n = 317 (8.42%)
Methionine (Met, M)
n = 307 (8.16%)
Proline (Pro, P)
n = 190 (5.05%)
Phenylalanine (Phe, F)
n = 190 (5.05%)
Tyrosine (Tyr, Y)
n = 118 (3.14%)
Tryptophan (Trp, W)
n = 97 (2.58%)
Aspartic acid (Asp, D)
n = 66 (1.75%)
Glutamic acid (Glu, E)
n = 76 (2.02%)
Asparagine (Asn, N)
n = 154 (4.09%)
Glutamine (Gln, Q)
n = 102 (2.71%)
Histidine (His, H)
n = 86 (2.29%)
Lysine (Lys, K)
n = 121 (3.22%)
Arginine (Arg, R)
n = 64 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
201 116 264 88 44 274 17 135 96 6 40 20 72 14 117 73
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 17 15 55 78 102 4 25 36 100 31 27 23 135 5 76
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 225 6 39 34 120 6 16 34 48 70 9 22 55 99 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 70 6 28 38 115 6 7 4 52 1 0 1 8 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
719 865 1378 802
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
436 1056 732 1540
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
178 866 1856 864

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.