Viewing data for Cacatua moluccensis


Scientific name Cacatua moluccensis
Common name Rose-crested cockatoo
Maximum lifespan 65.80 years (Cacatua moluccensis@AnAge)

Total mtDNA (size: 16828 bases) GC AT G C A T
Base content (bases) 7871 8874 5381 2490 3956 4918
Base content per 1 kb (bases) 468 527 320 148 235 292
Base content (%) 46.8% 52.7%
Total protein-coding genes (size: 11385 bases) GC AT G C A T
Base content (bases) 5370 6002 3877 1493 2703 3299
Base content per 1 kb (bases) 472 527 341 131 237 290
Base content (%) 47.2% 52.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 666 863 390 276 371 492
Base content per 1 kb (bases) 432 560 253 179 241 319
Base content (%) 43.2% 56.0%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1254 1290 760 494 470 820
Base content per 1 kb (bases) 487 501 295 192 182 318
Base content (%) 48.7% 50.1%
12S rRNA gene (size: 981 bases) GC AT G C A T
Base content (bases) 490 479 292 198 176 303
Base content per 1 kb (bases) 499 488 298 202 179 309
Base content (%) 49.9% 48.8%
16S rRNA gene (size: 1596 bases) GC AT G C A T
Base content (bases) 764 811 468 296 294 517
Base content per 1 kb (bases) 479 508 293 185 184 324
Base content (%) 47.9% 50.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 329 355 253 76 172 183
Base content per 1 kb (bases) 481 519 370 111 251 268
Base content (%) 48.1% 51.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 57 13 40 58
Base content per 1 kb (bases) 417 583 339 77 238 345
Base content (%) 41.7% 58.3%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 731 817 471 260 404 413
Base content per 1 kb (bases) 472 528 304 168 261 267
Base content (%) 47.2% 52.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 308 376 211 97 171 205
Base content per 1 kb (bases) 450 550 308 142 250 300
Base content (%) 45.0% 55.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 377 407 254 123 196 211
Base content per 1 kb (bases) 481 519 324 157 250 269
Base content (%) 48.1% 51.9%
CYTB (size: 1139 bases) GC AT G C A T
Base content (bases) 555 584 398 157 279 305
Base content per 1 kb (bases) 487 513 349 138 245 268
Base content (%) 48.7% 51.3%
ND1 (size: 981 bases) GC AT G C A T
Base content (bases) 469 512 338 131 248 264
Base content per 1 kb (bases) 478 522 345 134 253 269
Base content (%) 47.8% 52.2%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 470 570 373 97 241 329
Base content per 1 kb (bases) 452 548 359 93 232 316
Base content (%) 45.2% 54.8%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 156 195 114 42 90 105
Base content per 1 kb (bases) 444 556 325 120 256 299
Base content (%) 44.4% 55.6%
ND4 (size: 1393 bases) GC AT G C A T
Base content (bases) 659 734 502 157 332 402
Base content per 1 kb (bases) 473 527 360 113 238 289
Base content (%) 47.3% 52.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 103 41 76 77
Base content per 1 kb (bases) 485 515 347 138 256 259
Base content (%) 48.5% 51.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 847 968 621 226 401 567
Base content per 1 kb (bases) 467 533 342 125 221 312
Base content (%) 46.7% 53.3%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 261 245 185 76 58 187
Base content per 1 kb (bases) 503 472 356 146 112 360
Base content (%) 50.3% 47.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 31 (13.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 14 6 17 16 18 6 3 6 2 1 3 3 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 4 1 1 4 2 1 2 6 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 1 0 4 5 0 0 5 1 2 0 0 2 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 2 0 1 1 1 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 92 71 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 73 31 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 88 81 42
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLSTMIMAWLTLSLVIQPKVLSFTLTNPLTNKTALTTKANPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 0 5 3 0 1 1 1 1 0 1 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 1 1 0 0 0 0 0 2 1 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 0 4 0 0 0 0 0 0 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 22 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 11 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 17 25 11
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 26 (5.05%)
Threonine (Thr, T)
n = 39 (7.57%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.8%)
Leucine (Leu, L)
n = 66 (12.82%)
Isoleucine (Ile, I)
n = 41 (7.96%)
Methionine (Met, M)
n = 23 (4.47%)
Proline (Pro, P)
n = 31 (6.02%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 16 (3.11%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 23 11 12 28 4 11 5 5 6 11 15 3 14 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 14 20 10 2 5 14 22 6 4 11 15 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 0 3 10 10 0 0 3 1 15 3 0 3 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 3 3 12 8 1 0 3 4 1 0 1 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 124 131 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 208 187 91
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 10 5 10 14 2 2 7 1 5 7 3 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 6 3 4 0 0 1 5 1 1 3 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 0 2 8 8 0 0 2 2 7 0 1 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 5 4 9 4 0 1 2 1 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 54 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 59 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 89 90 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 6 1 12 14 1 5 8 2 3 3 6 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 5 9 9 0 2 5 10 2 3 4 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 1 7 7 1 0 5 0 10 2 0 0 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 4 4 2 2 2 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 68 59 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 71 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 115 97 33
CYTB (size: 1139 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.82%)
Alanine (Ala, A)
n = 28 (7.41%)
Serine (Ser, S)
n = 30 (7.94%)
Threonine (Thr, T)
n = 32 (8.47%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.97%)
Leucine (Leu, L)
n = 70 (18.52%)
Isoleucine (Ile, I)
n = 28 (7.41%)
Methionine (Met, M)
n = 6 (1.59%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 24 (6.35%)
Tyrosine (Tyr, Y)
n = 14 (3.7%)
Tryptophan (Trp, W)
n = 11 (2.91%)
Aspartic acid (Asp, D)
n = 6 (1.59%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 20 (5.29%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 11 (2.91%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 15 5 7 19 35 5 4 3 5 1 3 11 0 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 18 5 0 0 6 13 3 3 9 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 10 3 4 13 6 2 0 5 2 12 3 0 4 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 2 5 1 5 9 1 0 4 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 118 101 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 110 76 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 170 127 53
ND1 (size: 981 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.68%)
Alanine (Ala, A)
n = 28 (8.59%)
Serine (Ser, S)
n = 30 (9.2%)
Threonine (Thr, T)
n = 24 (7.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.99%)
Leucine (Leu, L)
n = 66 (20.25%)
Isoleucine (Ile, I)
n = 21 (6.44%)
Methionine (Met, M)
n = 14 (4.29%)
Proline (Pro, P)
n = 29 (8.9%)
Phenylalanine (Phe, F)
n = 17 (5.21%)
Tyrosine (Tyr, Y)
n = 14 (4.29%)
Tryptophan (Trp, W)
n = 9 (2.76%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.37%)
Asparagine (Asn, N)
n = 11 (3.37%)
Glutamine (Gln, Q)
n = 5 (1.53%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 7 (2.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 16 12 9 19 29 5 4 3 2 4 4 5 0 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 11 12 2 4 4 1 3 5 10 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 2 3 10 10 0 0 7 5 9 1 0 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 7 1 3 5 2 0 0 7 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 107 85 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 104 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 127 123 50
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 51 (14.78%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 70 (20.29%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 15 (4.35%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 24 14 10 23 26 3 8 7 2 0 0 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 8 7 9 1 1 5 4 2 1 10 9 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 19 2 3 10 16 0 0 5 1 5 1 0 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 1 14 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 102 128 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 127 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 144 145 39
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 51 (14.78%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 70 (20.29%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 15 (4.35%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 24 14 10 23 26 3 8 7 2 0 0 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 8 7 9 1 1 5 4 2 1 10 9 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 19 2 3 10 16 0 0 5 1 5 1 0 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 1 14 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 102 128 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 127 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 144 145 39
ND4 (size: 1393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.67%)
Alanine (Ala, A)
n = 35 (7.56%)
Serine (Ser, S)
n = 39 (8.42%)
Threonine (Thr, T)
n = 54 (11.66%)
Cysteine (Cys, C)
n = 5 (1.08%)
Valine (Val, V)
n = 11 (2.38%)
Leucine (Leu, L)
n = 102 (22.03%)
Isoleucine (Ile, I)
n = 31 (6.7%)
Methionine (Met, M)
n = 25 (5.4%)
Proline (Pro, P)
n = 31 (6.7%)
Phenylalanine (Phe, F)
n = 14 (3.02%)
Tyrosine (Tyr, Y)
n = 13 (2.81%)
Tryptophan (Trp, W)
n = 12 (2.59%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 9 (1.94%)
Asparagine (Asn, N)
n = 14 (3.02%)
Glutamine (Gln, Q)
n = 14 (3.02%)
Histidine (His, H)
n = 16 (3.46%)
Lysine (Lys, K)
n = 10 (2.16%)
Arginine (Arg, R)
n = 10 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 25 24 13 32 43 5 9 11 3 3 1 7 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 5 19 10 1 2 6 6 3 4 14 13 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 21 4 4 14 11 0 2 8 5 8 5 0 2 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 3 0 2 8 2 1 3 4 2 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 164 144 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 149 78 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 189 180 66
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 5 (5.1%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 4 3 1 15 1 1 1 1 0 1 1 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 2 7 2 0 1 1 0 2 1 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 1 7 2 0 0 2 1 0 0 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 33 21 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 17 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 39 39 15
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.13%)
Alanine (Ala, A)
n = 53 (8.77%)
Serine (Ser, S)
n = 50 (8.28%)
Threonine (Thr, T)
n = 73 (12.09%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 9 (1.49%)
Leucine (Leu, L)
n = 112 (18.54%)
Isoleucine (Ile, I)
n = 41 (6.79%)
Methionine (Met, M)
n = 37 (6.13%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 32 (5.3%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 28 (4.64%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 16 (2.65%)
Lysine (Lys, K)
n = 24 (3.97%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 34 14 27 56 10 5 11 6 2 2 5 0 5 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 8 29 15 1 1 7 19 4 1 11 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 30 1 4 21 9 3 0 13 2 9 3 0 6 22 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 7 1 7 20 4 0 3 4 1 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
113 174 216 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 189 117 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 258 234 68
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 31 (18.02%)
Leucine (Leu, L)
n = 27 (15.7%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 6 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.91%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 2 2 3 7 4 0 1 14 2 6 9 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 6 2 2 4 4 1 4 18 2 1 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 4 1 0 4 0 2 4 3 9 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 1 0 1 2 0 0 3 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 25 15 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 32 16 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 19 25 60
Total protein-coding genes (size: 11402 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.56%)
Alanine (Ala, A)
n = 301 (7.93%)
Serine (Ser, S)
n = 301 (7.93%)
Threonine (Thr, T)
n = 369 (9.72%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 160 (4.21%)
Leucine (Leu, L)
n = 699 (18.41%)
Isoleucine (Ile, I)
n = 257 (6.77%)
Methionine (Met, M)
n = 166 (4.37%)
Proline (Pro, P)
n = 227 (5.98%)
Phenylalanine (Phe, F)
n = 207 (5.45%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 132 (3.48%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
75 182 146 94 186 298 49 62 64 33 40 39 68 13 62 145
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
20 7 22 67 138 84 12 21 55 90 45 29 83 107 8 45
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
162 148 14 32 114 87 6 6 56 22 84 22 10 25 107 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 50 43 15 45 76 14 4 19 36 8 0 2 4 2 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
825 1123 1078 766
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
478 1136 689 1489
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
301 1511 1405 575

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.