Viewing data for Tropidophis haetianus


Scientific name Tropidophis haetianus
Common name Haitian dwarf boa
Maximum lifespan 15.30 years (Tropidophis haetianus@AnAge)

Total mtDNA (size: 17138 bases) GC AT G C A T
Base content (bases) 6624 10509 4404 2220 4559 5950
Base content per 1 kb (bases) 387 613 257 130 266 347
Base content (%) 38.7% 61.3%
Total protein-coding genes (size: 11273 bases) GC AT G C A T
Base content (bases) 4352 6918 3022 1330 2979 3939
Base content per 1 kb (bases) 386 614 268 118 264 349
Base content (%) 38.6% 61.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1432 bases) GC AT G C A T
Base content (bases) 569 861 335 234 380 481
Base content per 1 kb (bases) 397 601 234 163 265 336
Base content (%) 39.7% 60.1%
Total rRNA-coding genes (size: 2434 bases) GC AT G C A T
Base content (bases) 981 1453 559 422 525 928
Base content per 1 kb (bases) 403 597 230 173 216 381
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 922 bases) GC AT G C A T
Base content (bases) 392 530 221 171 194 336
Base content per 1 kb (bases) 425 575 240 185 210 364
Base content (%) 42.5% 57.5%
16S rRNA gene (size: 1512 bases) GC AT G C A T
Base content (bases) 589 923 338 251 331 592
Base content per 1 kb (bases) 390 610 224 166 219 392
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 272 409 193 79 183 226
Base content per 1 kb (bases) 399 601 283 116 269 332
Base content (%) 39.9% 60.1%
ATP8 (size: 161 bases) GC AT G C A T
Base content (bases) 43 118 29 14 45 73
Base content per 1 kb (bases) 267 733 180 87 280 453
Base content (%) 26.7% 73.3%
COX1 (size: 1572 bases) GC AT G C A T
Base content (bases) 636 933 400 236 446 487
Base content per 1 kb (bases) 405 594 254 150 284 310
Base content (%) 40.5% 59.4%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 299 391 187 112 162 229
Base content per 1 kb (bases) 433 567 271 162 235 332
Base content (%) 43.3% 56.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 323 461 210 113 212 249
Base content per 1 kb (bases) 412 588 268 144 270 318
Base content (%) 41.2% 58.8%
CYTB (size: 1113 bases) GC AT G C A T
Base content (bases) 411 702 287 124 335 367
Base content per 1 kb (bases) 369 631 258 111 301 330
Base content (%) 36.9% 63.1%
ND1 (size: 964 bases) GC AT G C A T
Base content (bases) 386 578 266 120 255 323
Base content per 1 kb (bases) 400 600 276 124 265 335
Base content (%) 40.0% 60.0%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 364 666 274 90 261 405
Base content per 1 kb (bases) 353 647 266 87 253 393
Base content (%) 35.3% 64.7%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 133 210 91 42 98 112
Base content per 1 kb (bases) 388 612 265 122 286 327
Base content (%) 38.8% 61.2%
ND4 (size: 1356 bases) GC AT G C A T
Base content (bases) 553 803 401 152 343 460
Base content per 1 kb (bases) 408 592 296 112 253 339
Base content (%) 40.8% 59.2%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 107 184 74 33 72 112
Base content per 1 kb (bases) 368 632 254 113 247 385
Base content (%) 36.8% 63.2%
ND5 (size: 1791 bases) GC AT G C A T
Base content (bases) 659 1132 480 179 466 666
Base content per 1 kb (bases) 368 632 268 100 260 372
Base content (%) 36.8% 63.2%
ND6 (size: 504 bases) GC AT G C A T
Base content (bases) 168 336 132 36 102 234
Base content per 1 kb (bases) 333 667 262 71 202 464
Base content (%) 33.3% 66.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 15 (6.64%)
Methionine (Met, M)
n = 23 (10.18%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 6 (2.65%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 1 (0.44%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 5 (2.21%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 16 12 4 21 4 8 7 0 2 4 6 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 3 7 6 1 1 5 1 0 1 3 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 16 0 3 3 3 1 3 1 3 1 0 1 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 3 1 0 0 3 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 70 80 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 63 39 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 60 107 43
ATP8 (size: 161 bases)
Amino acid sequence: MPQLETMNLFMTFMWTWLTFTLMTKKVSLFLLTTQHKNEKHKQELKSSWKMPW
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.77%)
Threonine (Thr, T)
n = 8 (15.38%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.92%)
Leucine (Leu, L)
n = 8 (15.38%)
Isoleucine (Ile, I)
n = 0 (0%)
Methionine (Met, M)
n = 6 (11.54%)
Proline (Pro, P)
n = 2 (3.85%)
Phenylalanine (Phe, F)
n = 4 (7.69%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.69%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.77%)
Asparagine (Asn, N)
n = 2 (3.85%)
Glutamine (Gln, Q)
n = 3 (5.77%)
Histidine (His, H)
n = 2 (3.85%)
Lysine (Lys, K)
n = 7 (13.46%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 0 5 0 0 3 0 4 2 1 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 0 2 0 0 0 0 0 0 1 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 0 0 5 2 0 0 0 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 10 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 13 17 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 6 32 9
COX1 (size: 1572 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.22%)
Alanine (Ala, A)
n = 40 (7.65%)
Serine (Ser, S)
n = 36 (6.88%)
Threonine (Thr, T)
n = 41 (7.84%)
Cysteine (Cys, C)
n = 4 (0.76%)
Valine (Val, V)
n = 32 (6.12%)
Leucine (Leu, L)
n = 60 (11.47%)
Isoleucine (Ile, I)
n = 43 (8.22%)
Methionine (Met, M)
n = 35 (6.69%)
Proline (Pro, P)
n = 30 (5.74%)
Phenylalanine (Phe, F)
n = 41 (7.84%)
Tyrosine (Tyr, Y)
n = 16 (3.06%)
Tryptophan (Trp, W)
n = 17 (3.25%)
Aspartic acid (Asp, D)
n = 13 (2.49%)
Glutamic acid (Glu, E)
n = 6 (1.15%)
Asparagine (Asn, N)
n = 18 (3.44%)
Glutamine (Gln, Q)
n = 8 (1.53%)
Histidine (His, H)
n = 19 (3.63%)
Lysine (Lys, K)
n = 11 (2.1%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 18 33 8 2 38 4 8 8 0 5 6 17 3 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 7 17 15 1 5 15 21 2 3 1 23 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 22 1 5 4 19 2 1 5 7 9 0 0 10 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 4 2 3 10 10 1 2 2 4 1 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
133 118 155 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 141 91 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 240 119
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 19 (8.3%)
Cysteine (Cys, C)
n = 5 (2.18%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 11 (4.8%)
Methionine (Met, M)
n = 9 (3.93%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 7 (3.06%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 8 (3.49%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 10 (4.37%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 4 6 6 3 17 1 2 9 1 0 4 15 1 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 4 6 7 1 0 5 1 2 0 1 11 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 11 1 2 3 8 1 0 2 1 6 1 0 3 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 2 2 6 4 0 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 66 52 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 65 62 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 56 115 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 21 (8.08%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 5 (1.92%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 7 8 7 2 23 0 3 7 0 4 4 12 1 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 5 10 0 2 8 8 1 3 1 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 1 0 5 7 0 1 2 4 6 0 0 4 2 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 2 2 5 0 0 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 70 64 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 68 56 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 72 129 54
CYTB (size: 1113 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.14%)
Alanine (Ala, A)
n = 27 (7.3%)
Serine (Ser, S)
n = 24 (6.49%)
Threonine (Thr, T)
n = 31 (8.38%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 14 (3.78%)
Leucine (Leu, L)
n = 49 (13.24%)
Isoleucine (Ile, I)
n = 41 (11.08%)
Methionine (Met, M)
n = 23 (6.22%)
Proline (Pro, P)
n = 23 (6.22%)
Phenylalanine (Phe, F)
n = 28 (7.57%)
Tyrosine (Tyr, Y)
n = 16 (4.32%)
Tryptophan (Trp, W)
n = 11 (2.97%)
Aspartic acid (Asp, D)
n = 5 (1.35%)
Glutamic acid (Glu, E)
n = 5 (1.35%)
Asparagine (Asn, N)
n = 19 (5.14%)
Glutamine (Gln, Q)
n = 7 (1.89%)
Histidine (His, H)
n = 11 (2.97%)
Lysine (Lys, K)
n = 9 (2.43%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 19 22 6 3 27 2 10 7 0 3 2 9 0 16 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 9 14 1 1 11 4 3 2 1 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 0 2 4 15 0 1 2 9 7 2 1 8 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 3 2 7 2 1 3 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 85 126 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 102 73 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 100 168 90
ND1 (size: 964 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 23 (7.19%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 28 (8.75%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.13%)
Leucine (Leu, L)
n = 52 (16.25%)
Isoleucine (Ile, I)
n = 21 (6.56%)
Methionine (Met, M)
n = 29 (9.06%)
Proline (Pro, P)
n = 24 (7.5%)
Phenylalanine (Phe, F)
n = 17 (5.31%)
Tyrosine (Tyr, Y)
n = 8 (2.5%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 13 (4.06%)
Glutamine (Gln, Q)
n = 10 (3.13%)
Histidine (His, H)
n = 6 (1.88%)
Lysine (Lys, K)
n = 9 (2.81%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 14 22 5 7 27 2 10 9 1 1 3 6 0 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 9 9 1 4 6 4 2 4 1 18 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 17 0 3 7 12 0 0 3 4 4 0 1 6 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 5 1 2 8 1 1 1 4 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 103 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 97 60 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 81 160 58
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.22%)
Alanine (Ala, A)
n = 23 (6.73%)
Serine (Ser, S)
n = 26 (7.6%)
Threonine (Thr, T)
n = 58 (16.96%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 31 (9.06%)
Methionine (Met, M)
n = 43 (12.57%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 10 (2.92%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 3 (0.88%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 11 (3.22%)
Glutamine (Gln, Q)
n = 8 (2.34%)
Histidine (His, H)
n = 7 (2.05%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 14 39 7 4 24 3 12 6 2 2 0 2 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 8 8 0 1 3 5 2 2 3 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 32 0 2 1 18 0 1 4 1 4 1 1 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 2 1 13 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 76 161 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 121 52 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 77 191 62
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.22%)
Alanine (Ala, A)
n = 23 (6.73%)
Serine (Ser, S)
n = 26 (7.6%)
Threonine (Thr, T)
n = 58 (16.96%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 31 (9.06%)
Methionine (Met, M)
n = 43 (12.57%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 10 (2.92%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 3 (0.88%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 11 (3.22%)
Glutamine (Gln, Q)
n = 8 (2.34%)
Histidine (His, H)
n = 7 (2.05%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 14 39 7 4 24 3 12 6 2 2 0 2 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 8 8 0 1 3 5 2 2 3 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 32 0 2 1 18 0 1 4 1 4 1 1 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 2 1 13 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 76 161 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 121 52 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 77 191 62
ND4 (size: 1356 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.55%)
Alanine (Ala, A)
n = 39 (8.65%)
Serine (Ser, S)
n = 31 (6.87%)
Threonine (Thr, T)
n = 55 (12.2%)
Cysteine (Cys, C)
n = 4 (0.89%)
Valine (Val, V)
n = 11 (2.44%)
Leucine (Leu, L)
n = 83 (18.4%)
Isoleucine (Ile, I)
n = 31 (6.87%)
Methionine (Met, M)
n = 37 (8.2%)
Proline (Pro, P)
n = 28 (6.21%)
Phenylalanine (Phe, F)
n = 17 (3.77%)
Tyrosine (Tyr, Y)
n = 13 (2.88%)
Tryptophan (Trp, W)
n = 9 (2.0%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 9 (2.0%)
Asparagine (Asn, N)
n = 21 (4.66%)
Glutamine (Gln, Q)
n = 13 (2.88%)
Histidine (His, H)
n = 9 (2.0%)
Lysine (Lys, K)
n = 13 (2.88%)
Arginine (Arg, R)
n = 9 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 14 29 11 11 45 4 10 11 2 1 1 9 0 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 2 6 17 16 0 3 4 7 2 3 4 20 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 31 0 6 10 9 1 0 5 6 7 3 2 8 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 4 1 2 11 2 0 2 6 1 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 130 163 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 148 81 179
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 123 216 83
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.17%)
Alanine (Ala, A)
n = 8 (8.33%)
Serine (Ser, S)
n = 7 (7.29%)
Threonine (Thr, T)
n = 12 (12.5%)
Cysteine (Cys, C)
n = 1 (1.04%)
Valine (Val, V)
n = 3 (3.13%)
Leucine (Leu, L)
n = 21 (21.88%)
Isoleucine (Ile, I)
n = 7 (7.29%)
Methionine (Met, M)
n = 12 (12.5%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 2 (2.08%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 3 (3.13%)
Asparagine (Asn, N)
n = 3 (3.13%)
Glutamine (Gln, Q)
n = 5 (5.21%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 2 (2.08%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 10 3 2 10 1 5 5 0 0 1 2 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 3 5 0 0 1 3 0 0 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 1 0 1 4 0 0 2 0 0 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 2 0 1 2 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 26 38 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 27 17 45
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 21 57 13
ND5 (size: 1791 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.03%)
Alanine (Ala, A)
n = 40 (6.71%)
Serine (Ser, S)
n = 43 (7.21%)
Threonine (Thr, T)
n = 80 (13.42%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 13 (2.18%)
Leucine (Leu, L)
n = 90 (15.1%)
Isoleucine (Ile, I)
n = 62 (10.4%)
Methionine (Met, M)
n = 45 (7.55%)
Proline (Pro, P)
n = 28 (4.7%)
Phenylalanine (Phe, F)
n = 25 (4.19%)
Tyrosine (Tyr, Y)
n = 9 (1.51%)
Tryptophan (Trp, W)
n = 10 (1.68%)
Aspartic acid (Asp, D)
n = 10 (1.68%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 34 (5.7%)
Glutamine (Gln, Q)
n = 21 (3.52%)
Histidine (His, H)
n = 12 (2.01%)
Lysine (Lys, K)
n = 29 (4.87%)
Arginine (Arg, R)
n = 7 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 28 41 14 11 46 1 17 18 3 2 3 6 2 14 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 11 14 14 1 2 8 10 4 3 5 19 1 19
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 40 1 5 7 23 0 0 8 3 6 3 1 15 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 4 6 23 6 1 1 5 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 140 258 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 183 128 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 157 280 131
ND6 (size: 504 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.57%)
Alanine (Ala, A)
n = 5 (2.99%)
Serine (Ser, S)
n = 11 (6.59%)
Threonine (Thr, T)
n = 5 (2.99%)
Cysteine (Cys, C)
n = 8 (4.79%)
Valine (Val, V)
n = 24 (14.37%)
Leucine (Leu, L)
n = 24 (14.37%)
Isoleucine (Ile, I)
n = 8 (4.79%)
Methionine (Met, M)
n = 14 (8.38%)
Proline (Pro, P)
n = 0 (0%)
Phenylalanine (Phe, F)
n = 19 (11.38%)
Tyrosine (Tyr, Y)
n = 6 (3.59%)
Tryptophan (Trp, W)
n = 4 (2.4%)
Aspartic acid (Asp, D)
n = 3 (1.8%)
Glutamic acid (Glu, E)
n = 2 (1.2%)
Asparagine (Asn, N)
n = 3 (1.8%)
Glutamine (Gln, Q)
n = 2 (1.2%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.8%)
Arginine (Arg, R)
n = 5 (2.99%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 8 3 0 0 1 10 1 1 12 0 8 4 18 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 7 1 3 0 1 1 11 1 4 5 0 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 4 0 3 0 4 0 4 2 3 10 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 2 1 2 1 1 1 2 1 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 11 38 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 17 19 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 8 45 81
Total protein-coding genes (size: 11280 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 193 (5.14%)
Alanine (Ala, A)
n = 262 (6.97%)
Serine (Ser, S)
n = 261 (6.95%)
Threonine (Thr, T)
n = 395 (10.51%)
Cysteine (Cys, C)
n = 32 (0.85%)
Valine (Val, V)
n = 169 (4.5%)
Leucine (Leu, L)
n = 576 (15.33%)
Isoleucine (Ile, I)
n = 294 (7.83%)
Methionine (Met, M)
n = 292 (7.77%)
Proline (Pro, P)
n = 202 (5.38%)
Phenylalanine (Phe, F)
n = 205 (5.46%)
Tyrosine (Tyr, Y)
n = 96 (2.56%)
Tryptophan (Trp, W)
n = 94 (2.5%)
Aspartic acid (Asp, D)
n = 58 (1.54%)
Glutamic acid (Glu, E)
n = 90 (2.4%)
Asparagine (Asn, N)
n = 155 (4.13%)
Glutamine (Gln, Q)
n = 104 (2.77%)
Histidine (His, H)
n = 97 (2.58%)
Lysine (Lys, K)
n = 111 (2.95%)
Arginine (Arg, R)
n = 63 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
154 140 245 84 51 297 23 103 93 11 32 30 93 13 112 92
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
47 15 17 51 95 108 8 30 70 68 25 22 21 151 8 86
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 216 6 33 46 129 5 12 36 42 54 13 18 69 86 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
60 70 20 21 37 94 17 6 12 40 5 2 1 4 1 81
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
771 921 1298 765
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
433 1072 716 1534
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
221 934 1794 806

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.