Viewing data for Coleonyx variegatus


Scientific name Coleonyx variegatus
Common name Western banded gecko
Maximum lifespan 15.20 years (Coleonyx variegatus@AnAge)

Total mtDNA (size: 17110 bases) GC AT G C A T
Base content (bases) 7489 9621 5116 2373 4114 5507
Base content per 1 kb (bases) 438 562 299 139 240 322
Base content (%) 43.8% 56.2%
Total protein-coding genes (size: 11333 bases) GC AT G C A T
Base content (bases) 4988 6345 3556 1432 2765 3580
Base content per 1 kb (bases) 440 560 314 126 244 316
Base content (%) 44.0% 56.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 656 882 399 257 377 505
Base content per 1 kb (bases) 427 573 259 167 245 328
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2471 bases) GC AT G C A T
Base content (bases) 1097 1374 665 432 499 875
Base content per 1 kb (bases) 444 556 269 175 202 354
Base content (%) 44.4% 55.6%
12S rRNA gene (size: 937 bases) GC AT G C A T
Base content (bases) 422 515 254 168 184 331
Base content per 1 kb (bases) 450 550 271 179 196 353
Base content (%) 45.0% 55.0%
16S rRNA gene (size: 1534 bases) GC AT G C A T
Base content (bases) 675 859 411 264 315 544
Base content per 1 kb (bases) 440 560 268 172 205 355
Base content (%) 44.0% 56.0%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 288 392 217 71 197 195
Base content per 1 kb (bases) 424 576 319 104 290 287
Base content (%) 42.4% 57.6%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 66 96 50 16 31 65
Base content per 1 kb (bases) 407 593 309 99 191 401
Base content (%) 40.7% 59.3%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 729 825 456 273 402 423
Base content per 1 kb (bases) 469 531 293 176 259 272
Base content (%) 46.9% 53.1%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 290 398 200 90 175 223
Base content per 1 kb (bases) 422 578 291 131 254 324
Base content (%) 42.2% 57.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 237 116 197 234
Base content per 1 kb (bases) 450 550 302 148 251 298
Base content (%) 45.0% 55.0%
CYTB (size: 1139 bases) GC AT G C A T
Base content (bases) 501 638 357 144 314 324
Base content per 1 kb (bases) 440 560 313 126 276 284
Base content (%) 44.0% 56.0%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 423 543 297 126 235 308
Base content per 1 kb (bases) 438 562 307 130 243 319
Base content (%) 43.8% 56.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 452 590 347 105 218 372
Base content per 1 kb (bases) 434 566 333 101 209 357
Base content (%) 43.4% 56.6%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 165 183 114 51 83 100
Base content per 1 kb (bases) 474 526 328 147 239 287
Base content (%) 47.4% 52.6%
ND4 (size: 1362 bases) GC AT G C A T
Base content (bases) 600 762 460 140 329 433
Base content per 1 kb (bases) 441 559 338 103 242 318
Base content (%) 44.1% 55.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 129 168 90 39 75 93
Base content per 1 kb (bases) 434 566 303 131 253 313
Base content (%) 43.4% 56.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 786 1035 585 201 451 584
Base content per 1 kb (bases) 432 568 321 110 248 321
Base content (%) 43.2% 56.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 217 305 153 64 66 239
Base content per 1 kb (bases) 416 584 293 123 126 458
Base content (%) 41.6% 58.4%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (4.0%)
Alanine (Ala, A)
n = 15 (6.67%)
Serine (Ser, S)
n = 6 (2.67%)
Threonine (Thr, T)
n = 23 (10.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.44%)
Leucine (Leu, L)
n = 56 (24.89%)
Isoleucine (Ile, I)
n = 25 (11.11%)
Methionine (Met, M)
n = 14 (6.22%)
Proline (Pro, P)
n = 17 (7.56%)
Phenylalanine (Phe, F)
n = 11 (4.89%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 1 (0.44%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.78%)
Asparagine (Asn, N)
n = 9 (4.0%)
Glutamine (Gln, Q)
n = 8 (3.56%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 3 (1.33%)
Arginine (Arg, R)
n = 5 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 13 14 7 25 4 5 7 1 3 3 2 2 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 8 6 0 1 2 3 3 6 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 7 0 1 2 0 0 0 3 2 3 0 1 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 3 0 0 1 3 1 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 84 77 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 58 34 116
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 75 83 54
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPGPWYLTMVAAWTIILLSTPTLMKIKTPHQPKLTKNGAQKPTWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (3.77%)
Alanine (Ala, A)
n = 3 (5.66%)
Serine (Ser, S)
n = 2 (3.77%)
Threonine (Thr, T)
n = 8 (15.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 6 (11.32%)
Isoleucine (Ile, I)
n = 3 (5.66%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 0 (0%)
Tyrosine (Tyr, Y)
n = 1 (1.89%)
Tryptophan (Trp, W)
n = 5 (9.43%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.77%)
Glutamine (Gln, Q)
n = 3 (5.66%)
Histidine (His, H)
n = 1 (1.89%)
Lysine (Lys, K)
n = 5 (9.43%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 0 3 2 0 1 3 0 0 0 1 0 0 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 1 0 1 0 2 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 1 1 0 0 0 0 1 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 4 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 21 10
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 21 13 13
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 12 31 8
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 44 (8.51%)
Serine (Ser, S)
n = 31 (6.0%)
Threonine (Thr, T)
n = 39 (7.54%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 40 (7.74%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 34 (6.58%)
Methionine (Met, M)
n = 30 (5.8%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 38 (7.35%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 16 (3.09%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 21 (4.06%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 28 9 9 21 12 10 5 2 8 12 19 1 12 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 8 20 15 1 4 20 16 7 4 8 16 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 15 3 4 9 14 0 4 0 4 15 1 1 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 6 5 5 10 7 1 1 1 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 115 132 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 138 97 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 203 194 84
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 20 (8.77%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 12 6 4 13 1 6 8 1 2 2 7 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 5 6 0 0 1 5 2 2 3 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 5 6 6 0 0 3 5 3 0 0 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 1 3 6 2 0 0 3 2 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 60 65 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 59 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 77 99 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 11 (4.23%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 10 9 4 11 0 7 7 0 0 5 8 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 12 9 0 4 4 9 3 0 4 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 0 1 7 0 0 3 4 7 0 0 1 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 0 4 2 0 0 1 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 64 68 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 68 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 105 109 40
CYTB (size: 1139 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.35%)
Alanine (Ala, A)
n = 24 (6.35%)
Serine (Ser, S)
n = 28 (7.41%)
Threonine (Thr, T)
n = 25 (6.61%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 14 (3.7%)
Leucine (Leu, L)
n = 57 (15.08%)
Isoleucine (Ile, I)
n = 38 (10.05%)
Methionine (Met, M)
n = 14 (3.7%)
Proline (Pro, P)
n = 23 (6.08%)
Phenylalanine (Phe, F)
n = 29 (7.67%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.12%)
Glutamic acid (Glu, E)
n = 6 (1.59%)
Asparagine (Asn, N)
n = 22 (5.82%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.12%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 22 13 9 13 24 4 7 8 0 4 2 7 1 10 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 10 9 1 1 8 12 3 2 8 12 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 5 14 6 1 1 1 3 12 1 0 2 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 4 4 7 1 1 2 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 101 109 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 98 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 158 135 68
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.67%)
Alanine (Ala, A)
n = 23 (7.17%)
Serine (Ser, S)
n = 22 (6.85%)
Threonine (Thr, T)
n = 29 (9.03%)
Cysteine (Cys, C)
n = 5 (1.56%)
Valine (Val, V)
n = 11 (3.43%)
Leucine (Leu, L)
n = 67 (20.87%)
Isoleucine (Ile, I)
n = 19 (5.92%)
Methionine (Met, M)
n = 17 (5.3%)
Proline (Pro, P)
n = 22 (6.85%)
Phenylalanine (Phe, F)
n = 16 (4.98%)
Tyrosine (Tyr, Y)
n = 11 (3.43%)
Tryptophan (Trp, W)
n = 9 (2.8%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 7 (2.18%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 12 5 7 41 4 8 6 1 1 5 4 1 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 5 3 9 9 2 1 4 7 3 0 9 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 3 2 2 16 0 1 1 0 11 2 2 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 0 1 3 8 0 0 1 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 98 88 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 105 161 33
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 66 (19.08%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 28 (8.09%)
Methionine (Met, M)
n = 23 (6.65%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 21 8 17 27 3 7 10 0 0 2 0 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 12 16 0 2 3 6 2 0 1 15 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 32 2 1 6 12 0 2 9 1 5 1 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 2 11 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 95 148 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 131 51 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 121 173 40
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 66 (19.08%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 28 (8.09%)
Methionine (Met, M)
n = 23 (6.65%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 21 8 17 27 3 7 10 0 0 2 0 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 12 16 0 2 3 6 2 0 1 15 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 32 2 1 6 12 0 2 9 1 5 1 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 2 11 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 95 148 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 131 51 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 121 173 40
ND4 (size: 1362 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.97%)
Alanine (Ala, A)
n = 34 (7.51%)
Serine (Ser, S)
n = 28 (6.18%)
Threonine (Thr, T)
n = 58 (12.8%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 7 (1.55%)
Leucine (Leu, L)
n = 91 (20.09%)
Isoleucine (Ile, I)
n = 43 (9.49%)
Methionine (Met, M)
n = 32 (7.06%)
Proline (Pro, P)
n = 29 (6.4%)
Phenylalanine (Phe, F)
n = 17 (3.75%)
Tyrosine (Tyr, Y)
n = 14 (3.09%)
Tryptophan (Trp, W)
n = 10 (2.21%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 6 (1.32%)
Asparagine (Asn, N)
n = 15 (3.31%)
Glutamine (Gln, Q)
n = 9 (1.99%)
Histidine (His, H)
n = 15 (3.31%)
Lysine (Lys, K)
n = 10 (2.21%)
Arginine (Arg, R)
n = 11 (2.43%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 31 27 14 16 43 4 13 8 1 0 4 3 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 3 13 18 0 2 10 5 1 1 11 16 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 24 0 1 8 9 1 3 6 4 10 2 1 5 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 3 3 1 2 9 1 0 4 6 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 141 167 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 140 73 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 179 193 61
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (2.04%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 13 (13.27%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 7 3 2 11 1 3 3 0 1 1 1 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 3 1 0 0 0 2 0 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 1 1 0 3 1 0 2 0 0 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 27 33 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 17 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 32 43 15
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 49 (8.09%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 75 (12.38%)
Cysteine (Cys, C)
n = 8 (1.32%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 92 (15.18%)
Isoleucine (Ile, I)
n = 52 (8.58%)
Methionine (Met, M)
n = 32 (5.28%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 36 (5.94%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 29 (4.79%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.3%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 32 27 16 22 30 6 18 28 1 2 4 6 1 16 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 4 4 4 27 18 0 2 15 10 1 2 10 16 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 30 3 10 15 10 0 0 11 3 12 1 0 4 23 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 2 8 18 2 0 2 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 153 217 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 187 126 225
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 245 241 100
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 19 (10.98%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 6 (3.47%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 3 (1.73%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 2 (1.16%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 0 7 1 0 0 14 0 0 9 0 5 8 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 6 0 11 1 4 2 12 1 2 10 1 0 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 10 1 3 2 3 0 9 0 1 10 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 0 0 0 2 0 0 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 16 16 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 42 18 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 6 32 93
Total protein-coding genes (size: 11365 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.71%)
Alanine (Ala, A)
n = 298 (7.87%)
Serine (Ser, S)
n = 256 (6.76%)
Threonine (Thr, T)
n = 394 (10.41%)
Cysteine (Cys, C)
n = 39 (1.03%)
Valine (Val, V)
n = 150 (3.96%)
Leucine (Leu, L)
n = 634 (16.75%)
Isoleucine (Ile, I)
n = 298 (7.87%)
Methionine (Met, M)
n = 206 (5.44%)
Proline (Pro, P)
n = 211 (5.57%)
Phenylalanine (Phe, F)
n = 211 (5.57%)
Tyrosine (Tyr, Y)
n = 117 (3.09%)
Tryptophan (Trp, W)
n = 101 (2.67%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 87 (2.3%)
Asparagine (Asn, N)
n = 136 (3.59%)
Glutamine (Gln, Q)
n = 102 (2.69%)
Histidine (His, H)
n = 110 (2.91%)
Lysine (Lys, K)
n = 80 (2.11%)
Arginine (Arg, R)
n = 69 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
116 182 175 101 115 258 40 103 94 8 30 40 63 17 84 127
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 13 26 42 129 119 8 29 72 76 39 19 63 123 6 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
157 165 15 40 67 88 5 14 42 35 82 10 17 27 109 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
93 68 19 19 44 74 6 4 17 42 6 0 1 6 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
814 1006 1171 795
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
482 1103 702 1499
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
229 1365 1545 647

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.