Viewing data for Cercopithecus diana


Scientific name Cercopithecus diana
Common name Diana monkey
Maximum lifespan 35.10 years (Cercopithecus diana@AnAge)

Total mtDNA (size: 16505 bases) GC AT G C A T
Base content (bases) 7070 9435 4969 2101 4173 5262
Base content per 1 kb (bases) 428 572 301 127 253 319
Base content (%) 42.8% 57.2%
Total protein-coding genes (size: 11358 bases) GC AT G C A T
Base content (bases) 4856 6502 3581 1275 2963 3539
Base content per 1 kb (bases) 428 572 315 112 261 312
Base content (%) 42.8% 57.2%
D-loop (size: 1069 bases) GC AT G C A T
Base content (bases) 484 585 334 150 281 304
Base content per 1 kb (bases) 453 547 312 140 263 284
Base content (%) 45.3% 54.7%
Total tRNA-coding genes (size: 1497 bases) GC AT G C A T
Base content (bases) 601 896 368 233 380 516
Base content per 1 kb (bases) 401 599 246 156 254 345
Base content (%) 40.1% 59.9%
Total rRNA-coding genes (size: 2507 bases) GC AT G C A T
Base content (bases) 1098 1409 659 439 529 880
Base content per 1 kb (bases) 438 562 263 175 211 351
Base content (%) 43.8% 56.2%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 433 516 263 170 193 323
Base content per 1 kb (bases) 456 544 277 179 203 340
Base content (%) 45.6% 54.4%
16S rRNA gene (size: 1558 bases) GC AT G C A T
Base content (bases) 665 893 396 269 336 557
Base content per 1 kb (bases) 427 573 254 173 216 358
Base content (%) 42.7% 57.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 295 386 228 67 167 219
Base content per 1 kb (bases) 433 567 335 98 245 322
Base content (%) 43.3% 56.7%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 68 124 60 8 44 80
Base content per 1 kb (bases) 354 646 313 42 229 417
Base content (%) 35.4% 64.6%
COX1 (size: 1569 bases) GC AT G C A T
Base content (bases) 687 882 428 259 461 421
Base content per 1 kb (bases) 438 562 273 165 294 268
Base content (%) 43.8% 56.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 297 387 203 94 174 213
Base content per 1 kb (bases) 434 566 297 137 254 311
Base content (%) 43.4% 56.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 242 111 220 211
Base content per 1 kb (bases) 450 550 309 142 281 269
Base content (%) 45.0% 55.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 503 638 371 132 307 331
Base content per 1 kb (bases) 441 559 325 116 269 290
Base content (%) 44.1% 55.9%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 426 529 313 113 250 279
Base content per 1 kb (bases) 446 554 328 118 262 292
Base content (%) 44.6% 55.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 432 610 355 77 245 365
Base content per 1 kb (bases) 415 585 341 74 235 350
Base content (%) 41.5% 58.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 140 206 106 34 91 115
Base content per 1 kb (bases) 405 595 306 98 263 332
Base content (%) 40.5% 59.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 567 811 440 127 367 444
Base content per 1 kb (bases) 411 589 319 92 266 322
Base content (%) 41.1% 58.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 124 173 90 34 90 83
Base content per 1 kb (bases) 418 582 303 114 303 279
Base content (%) 41.8% 58.2%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 759 1047 571 188 469 578
Base content per 1 kb (bases) 420 580 316 104 260 320
Base content (%) 42.0% 58.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 214 308 179 35 93 215
Base content per 1 kb (bases) 410 590 343 67 178 412
Base content (%) 41.0% 59.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 12 10 2 7 29 5 3 8 1 2 2 5 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 8 8 0 0 4 3 0 1 6 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 9 1 4 2 2 0 3 2 2 1 0 0 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 0 3 2 0 2 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 76 85 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 70 40 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 82 94 40
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWFTIIMTTLLTLYLIMQLKLLNMNYYQPPLQKTPNKQTSSNHWQLKWTKIYLPLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.35%)
Threonine (Thr, T)
n = 9 (14.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (19.05%)
Isoleucine (Ile, I)
n = 4 (6.35%)
Methionine (Met, M)
n = 4 (6.35%)
Proline (Pro, P)
n = 5 (7.94%)
Phenylalanine (Phe, F)
n = 1 (1.59%)
Tyrosine (Tyr, Y)
n = 4 (6.35%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (6.35%)
Glutamine (Gln, Q)
n = 6 (9.52%)
Histidine (His, H)
n = 1 (1.59%)
Lysine (Lys, K)
n = 5 (7.94%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 3 2 2 7 0 1 6 0 0 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 3 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 1 0 2 1 0 1 0 1 3 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 5 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 23 27 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 17 22 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 31 10
COX1 (size: 1569 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.2%)
Alanine (Ala, A)
n = 39 (7.47%)
Serine (Ser, S)
n = 36 (6.9%)
Threonine (Thr, T)
n = 35 (6.7%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 31 (5.94%)
Leucine (Leu, L)
n = 60 (11.49%)
Isoleucine (Ile, I)
n = 45 (8.62%)
Methionine (Met, M)
n = 30 (5.75%)
Proline (Pro, P)
n = 30 (5.75%)
Phenylalanine (Phe, F)
n = 41 (7.85%)
Tyrosine (Tyr, Y)
n = 20 (3.83%)
Tryptophan (Trp, W)
n = 16 (3.07%)
Aspartic acid (Asp, D)
n = 14 (2.68%)
Glutamic acid (Glu, E)
n = 11 (2.11%)
Asparagine (Asn, N)
n = 19 (3.64%)
Glutamine (Gln, Q)
n = 7 (1.34%)
Histidine (His, H)
n = 19 (3.64%)
Lysine (Lys, K)
n = 11 (2.11%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 21 22 6 9 23 6 15 6 1 7 7 17 0 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 9 18 12 0 6 17 18 7 7 16 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 1 9 12 9 1 2 3 10 10 4 1 10 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 4 7 4 10 11 0 3 2 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
143 109 145 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 102 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 184 174 128
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 8 3 5 15 3 3 7 0 6 4 1 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 7 4 0 2 3 4 2 2 6 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 0 7 4 0 1 1 7 3 0 2 1 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 4 5 4 0 2 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 60 70 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 63 56 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 80 87 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 39 (15.0%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 19 (7.31%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 6 2 11 13 3 8 8 0 1 6 5 1 3 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 8 2 1 4 6 7 1 2 6 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 7 1 8 0 3 2 5 6 1 2 3 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 4 2 2 1 3 0 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 72 65 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 68 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 102 91 53
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 20 (5.28%)
Serine (Ser, S)
n = 31 (8.18%)
Threonine (Thr, T)
n = 32 (8.44%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 12 (3.17%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 34 (8.97%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 17 15 8 19 28 4 6 8 1 2 4 6 0 10 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 7 9 0 3 12 6 1 2 7 13 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 0 0 13 12 0 0 6 5 9 1 1 3 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 2 1 2 7 9 2 1 2 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 111 116 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 73 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 158 142 64
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 33 (10.41%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 11 (3.47%)
Leucine (Leu, L)
n = 62 (19.56%)
Isoleucine (Ile, I)
n = 19 (5.99%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 14 (4.42%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 15 8 18 30 0 4 6 0 2 4 5 0 4 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 14 10 0 4 5 2 2 6 9 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 1 2 6 9 1 1 2 4 7 1 2 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 2 7 0 1 1 4 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 93 93 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 101 55 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 119 131 55
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 14 (4.05%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 59 (17.05%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 26 (7.51%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 20 (5.78%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 25 12 12 27 7 4 11 0 0 3 0 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 7 5 0 2 6 6 0 5 10 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 27 0 2 9 11 0 0 4 4 7 0 0 3 17 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 10 1 1 2 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 100 154 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 119 62 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 136 149 52
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 14 (4.05%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 59 (17.05%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 26 (7.51%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 20 (5.78%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 25 12 12 27 7 4 11 0 0 3 0 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 7 5 0 2 6 6 0 5 10 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 27 0 2 9 11 0 0 4 4 7 0 0 3 17 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 10 1 1 2 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 100 154 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 119 62 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 136 149 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 25 (5.46%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 89 (19.43%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 25 (5.46%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 35 11 25 33 5 15 10 0 2 3 5 2 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 5 13 6 1 2 9 5 1 4 14 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 26 0 5 14 9 0 2 6 4 9 1 0 6 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 0 2 1 12 1 1 2 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 132 170 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 126 88 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 182 186 77
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 6 7 5 3 10 1 0 1 0 1 1 3 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 3 1 0 0 3 0 1 1 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 0 3 6 0 0 1 2 0 0 1 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 1 0 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 28 33 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 25 16 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 37 34 21
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 34 (5.66%)
Serine (Ser, S)
n = 49 (8.15%)
Threonine (Thr, T)
n = 67 (11.15%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 14 (2.33%)
Leucine (Leu, L)
n = 98 (16.31%)
Isoleucine (Ile, I)
n = 53 (8.82%)
Methionine (Met, M)
n = 44 (7.32%)
Proline (Pro, P)
n = 29 (4.83%)
Phenylalanine (Phe, F)
n = 34 (5.66%)
Tyrosine (Tyr, Y)
n = 19 (3.16%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 11 (1.83%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 34 (5.66%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 32 40 17 26 41 7 6 17 3 2 6 5 1 12 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 4 20 9 1 4 12 9 1 2 11 16 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 23 2 4 18 14 0 4 9 9 10 3 1 7 27 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 6 5 16 5 0 5 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
94 161 232 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 166 128 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 244 218 111
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (17.92%)
Alanine (Ala, A)
n = 7 (4.05%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 7 (4.05%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 24 (13.87%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 11 (6.36%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 9 (5.2%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 1 0 0 3 0 10 0 0 13 0 4 9 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 4 0 0 3 14 2 3 12 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 5 0 0 1 3 0 8 1 3 11 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 4 0 0 1 1 0 1 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 9 36 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 23 26 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 3 31 82
Total protein-coding genes (size: 11397 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 230 (6.06%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 387 (10.19%)
Cysteine (Cys, C)
n = 21 (0.55%)
Valine (Val, V)
n = 150 (3.95%)
Leucine (Leu, L)
n = 634 (16.7%)
Isoleucine (Ile, I)
n = 320 (8.43%)
Methionine (Met, M)
n = 232 (6.11%)
Proline (Pro, P)
n = 213 (5.61%)
Phenylalanine (Phe, F)
n = 212 (5.58%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 102 (2.69%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 83 (2.19%)
Asparagine (Asn, N)
n = 173 (4.56%)
Glutamine (Gln, Q)
n = 97 (2.56%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 61 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
142 178 191 80 139 274 41 79 91 6 38 41 57 14 82 130
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 5 16 47 110 67 6 41 80 64 28 37 93 76 7 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
153 170 8 38 88 88 3 20 37 62 68 15 21 47 126 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 59 24 26 35 83 13 11 20 28 2 0 1 5 1 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
737 1006 1266 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
455 1047 747 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
231 1389 1419 758

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.