Viewing data for Anguilla nebulosa


Scientific name Anguilla nebulosa
Common name Long-finned eel
Maximum lifespan 15.00 years (Anguilla nebulosa@AnAge)

Total mtDNA (size: 16707 bases) GC AT G C A T
Base content (bases) 6885 9822 4324 2561 4129 5693
Base content per 1 kb (bases) 412 588 259 153 247 341
Base content (%) 41.2% 58.8%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4731 6716 3124 1607 2928 3788
Base content per 1 kb (bases) 413 587 273 140 256 331
Base content (%) 41.3% 58.7%
D-loop (size: 982 bases) GC AT G C A T
Base content (bases) 296 686 181 115 296 390
Base content per 1 kb (bases) 301 699 184 117 301 397
Base content (%) 30.1% 69.9%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 669 893 378 291 385 508
Base content per 1 kb (bases) 428 572 242 186 246 325
Base content (%) 42.8% 57.2%
Total rRNA-coding genes (size: 2658 bases) GC AT G C A T
Base content (bases) 1158 1500 628 530 509 991
Base content per 1 kb (bases) 436 564 236 199 191 373
Base content (%) 43.6% 56.4%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 440 508 239 201 185 323
Base content per 1 kb (bases) 464 536 252 212 195 341
Base content (%) 46.4% 53.6%
16S rRNA gene (size: 1710 bases) GC AT G C A T
Base content (bases) 718 992 389 329 324 668
Base content per 1 kb (bases) 420 580 227 192 189 391
Base content (%) 42.0% 58.0%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 279 404 192 87 192 212
Base content per 1 kb (bases) 408 592 281 127 281 310
Base content (%) 40.8% 59.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 67 101 45 22 42 59
Base content per 1 kb (bases) 399 601 268 131 250 351
Base content (%) 39.9% 60.1%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 677 916 401 276 452 464
Base content per 1 kb (bases) 425 575 252 173 284 291
Base content (%) 42.5% 57.5%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 295 396 175 120 173 223
Base content per 1 kb (bases) 427 573 253 174 250 323
Base content (%) 42.7% 57.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 340 445 214 126 208 237
Base content per 1 kb (bases) 433 567 273 161 265 302
Base content (%) 43.3% 56.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 471 669 311 160 318 351
Base content per 1 kb (bases) 413 587 273 140 279 308
Base content (%) 41.3% 58.7%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 421 551 287 134 237 314
Base content per 1 kb (bases) 433 567 295 138 244 323
Base content (%) 43.3% 56.7%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 404 641 286 118 226 415
Base content per 1 kb (bases) 387 613 274 113 216 397
Base content (%) 38.7% 61.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 146 203 97 49 106 97
Base content per 1 kb (bases) 418 582 278 140 304 278
Base content (%) 41.8% 58.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 569 812 377 192 357 455
Base content per 1 kb (bases) 412 588 273 139 259 329
Base content (%) 41.2% 58.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 97 38 79 83
Base content per 1 kb (bases) 455 545 327 128 266 279
Base content (%) 45.5% 54.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 722 1120 488 234 472 648
Base content per 1 kb (bases) 392 608 265 127 256 352
Base content (%) 39.2% 60.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 208 314 155 53 74 240
Base content per 1 kb (bases) 398 602 297 102 142 460
Base content (%) 39.8% 60.2%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 53 (23.45%)
Isoleucine (Ile, I)
n = 20 (8.85%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 6 7 7 27 4 8 9 0 1 3 9 2 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 3 8 0 2 2 7 0 2 2 10 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 3 1 0 0 4 0 3 1 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 1 0 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 79 67 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 30 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 54 114 45
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAILPTKVMAHTFNNEPNLQTAKKPKMDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 1 0 1 1 2 1 1 0 0 2 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 0 3 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 1 0 1 0 0 0 0 1 1 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 13 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 14 25 10
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 46 (8.68%)
Serine (Ser, S)
n = 26 (4.91%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 63 (11.89%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 15 (2.83%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 16 (3.02%)
Glutamine (Gln, Q)
n = 9 (1.7%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 11 (2.08%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 18 10 8 23 9 12 9 0 8 9 24 3 19 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 14 16 13 3 10 5 28 5 6 2 21 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 0 3 7 12 0 1 3 9 10 0 1 7 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 14 0 4 11 11 0 4 0 5 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
167 118 132 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 136 104 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 147 228 128
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 20 (8.73%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 8 4 1 13 3 6 8 1 5 2 10 4 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 0 6 13 1 1 1 7 0 2 3 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 2 2 6 1 0 3 4 5 0 0 0 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 2 11 3 0 0 1 4 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 60 51 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 61 109 42
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 8 2 4 19 1 4 9 0 6 2 9 1 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 13 8 0 2 6 12 1 1 2 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 0 2 8 0 1 2 8 4 1 0 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 1 4 3 0 0 1 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 67 56 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 79 125 49
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 12 11 11 6 31 0 10 5 1 3 4 21 1 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 6 11 10 0 1 7 14 4 1 0 21 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 5 5 13 1 0 0 4 12 0 1 4 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 3 9 8 1 0 1 7 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 96 89 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 81 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 122 181 66
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.19%)
Alanine (Ala, A)
n = 33 (10.22%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 23 (7.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (5.26%)
Leucine (Leu, L)
n = 59 (18.27%)
Isoleucine (Ile, I)
n = 22 (6.81%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 13 (4.02%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 12 9 7 31 2 9 5 0 3 2 11 1 5 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 20 12 0 0 6 13 1 2 2 19 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 1 3 11 1 0 2 4 9 0 1 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 3 8 0 2 0 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 89 87 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 96 60 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 102 167 43
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 56 (16.14%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 32 4 5 37 5 5 14 0 0 1 9 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 13 12 1 2 1 16 0 0 3 15 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 34 1 1 1 13 0 0 4 2 6 0 0 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 95 136 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 78 220 39
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 31 (8.93%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 56 (16.14%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 32 4 5 37 5 5 14 0 0 1 9 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 13 12 1 2 1 16 0 0 3 15 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 34 1 1 1 13 0 0 4 2 6 0 0 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 95 136 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 78 220 39
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 20 25 8 13 37 9 18 10 1 2 3 9 2 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 4 13 17 0 5 4 18 2 3 4 17 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 18 1 4 5 13 1 1 5 4 11 0 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 1 0 5 12 1 1 1 9 1 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 124 143 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 121 78 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 132 234 70
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 7 2 2 12 1 2 2 0 0 0 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 7 4 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 0 5 4 0 0 2 0 1 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 1 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 28 22 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 37 45 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 50 (8.16%)
Serine (Ser, S)
n = 35 (5.71%)
Threonine (Thr, T)
n = 58 (9.46%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.73%)
Leucine (Leu, L)
n = 87 (14.19%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 37 (6.04%)
Proline (Pro, P)
n = 31 (5.06%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 30 29 10 11 44 5 15 21 1 9 4 15 1 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 4 2 5 22 23 0 5 7 18 1 2 3 23 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 34 3 2 6 15 1 1 10 2 10 2 2 6 28 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 1 8 5 26 0 0 0 9 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 145 219 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 163 133 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 180 296 110
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 1 7 0 0 2 8 0 0 8 1 3 7 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 0 12 0 4 0 9 1 2 13 2 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 2 1 3 0 12 1 2 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 5 0 0 0 4 0 1 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 19 20 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 4 29 99
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 249 (6.52%)
Alanine (Ala, A)
n = 318 (8.33%)
Serine (Ser, S)
n = 219 (5.73%)
Threonine (Thr, T)
n = 304 (7.96%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 227 (5.94%)
Leucine (Leu, L)
n = 594 (15.55%)
Isoleucine (Ile, I)
n = 288 (7.54%)
Methionine (Met, M)
n = 206 (5.39%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 232 (6.07%)
Tyrosine (Tyr, Y)
n = 124 (3.25%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 82 (2.15%)
Glutamic acid (Glu, E)
n = 102 (2.67%)
Asparagine (Asn, N)
n = 133 (3.48%)
Glutamine (Gln, Q)
n = 101 (2.64%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
150 138 161 79 68 285 45 99 95 6 45 32 127 23 102 130
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 14 16 56 128 129 5 37 44 141 27 24 26 154 10 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
84 168 6 25 42 104 6 7 35 50 74 7 18 37 96 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 94 8 26 56 91 2 13 5 55 4 0 1 6 0 114
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
978 968 1067 807
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
520 1013 740 1547
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
213 1042 1823 742

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.