Viewing data for Aepyceros melampus


Scientific name Aepyceros melampus
Common name Impala
Maximum lifespan 25.60 years (Aepyceros melampus@AnAge)

Total mtDNA (size: 16422 bases) GC AT G C A T
Base content (bases) 6265 10157 4160 2105 4566 5591
Base content per 1 kb (bases) 382 618 253 128 278 340
Base content (%) 38.2% 61.8%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4325 7016 3035 1290 3241 3775
Base content per 1 kb (bases) 381 619 268 114 286 333
Base content (%) 38.1% 61.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 540 970 318 222 426 544
Base content per 1 kb (bases) 358 642 211 147 282 360
Base content (%) 35.8% 64.2%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 981 1546 546 435 594 952
Base content per 1 kb (bases) 388 612 216 172 235 377
Base content (%) 38.8% 61.2%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 392 563 217 175 217 346
Base content per 1 kb (bases) 410 590 227 183 227 362
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 589 983 329 260 377 606
Base content per 1 kb (bases) 375 625 209 165 240 385
Base content (%) 37.5% 62.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 257 424 188 69 192 232
Base content per 1 kb (bases) 377 623 276 101 282 341
Base content (%) 37.7% 62.3%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 62 145 49 13 64 81
Base content per 1 kb (bases) 300 700 237 63 309 391
Base content (%) 30.0% 70.0%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 608 937 368 240 478 459
Base content per 1 kb (bases) 394 606 238 155 309 297
Base content (%) 39.4% 60.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 254 430 162 92 185 245
Base content per 1 kb (bases) 371 629 237 135 270 358
Base content (%) 37.1% 62.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 334 450 224 110 236 214
Base content per 1 kb (bases) 426 574 286 140 301 273
Base content (%) 42.6% 57.4%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 466 677 322 144 307 370
Base content per 1 kb (bases) 408 592 282 126 269 324
Base content (%) 40.8% 59.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 378 578 261 117 270 308
Base content per 1 kb (bases) 395 605 273 122 282 322
Base content (%) 39.5% 60.5%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 378 664 293 85 279 385
Base content per 1 kb (bases) 363 637 281 82 268 369
Base content (%) 36.3% 63.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 136 210 98 38 99 111
Base content per 1 kb (bases) 393 607 283 110 286 321
Base content (%) 39.3% 60.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 518 860 378 140 405 455
Base content per 1 kb (bases) 376 624 274 102 294 330
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 106 191 69 37 99 92
Base content per 1 kb (bases) 357 643 232 125 333 310
Base content (%) 35.7% 64.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 673 1148 494 179 534 614
Base content per 1 kb (bases) 370 630 271 98 293 337
Base content (%) 37.0% 63.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 177 351 144 33 118 233
Base content per 1 kb (bases) 335 665 273 63 223 441
Base content (%) 33.5% 66.5%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 15 4 10 14 4 14 9 0 1 1 6 0 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 6 9 0 0 6 5 0 1 4 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 0 1 2 6 0 1 4 0 2 0 0 4 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 3 1 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 63 84 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 38 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 65 110 46
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIIFQLKISKYNFYYNPELTSIKTPKQNTPWETKWTKIYLPLSLPPYY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.35%)
Threonine (Thr, T)
n = 9 (13.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (14.71%)
Isoleucine (Ile, I)
n = 6 (8.82%)
Methionine (Met, M)
n = 3 (4.41%)
Proline (Pro, P)
n = 7 (10.29%)
Phenylalanine (Phe, F)
n = 4 (5.88%)
Tyrosine (Tyr, Y)
n = 6 (8.82%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 2 (2.94%)
Asparagine (Asn, N)
n = 3 (4.41%)
Glutamine (Gln, Q)
n = 3 (4.41%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 2 1 3 3 1 1 3 0 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 0 1 4 0 0 0 6 0 1 1 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 5 1 0 0 0 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 18 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 22 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 10 32 20
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 31 9 4 27 5 13 6 0 9 8 20 0 24 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 10 13 16 0 12 7 22 6 7 9 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 1 10 3 14 0 1 2 12 7 0 2 10 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 7 9 9 0 1 1 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 104 141 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 131 222 146
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 14 4 2 14 4 9 6 0 4 1 5 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 3 6 0 1 2 5 0 1 3 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 2 5 9 0 2 3 4 7 1 1 2 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 13 2 5 5 4 2 1 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 56 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 51 116 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 9 5 8 11 2 6 7 0 3 6 6 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 7 4 0 6 6 8 0 2 5 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 1 5 3 7 0 0 5 5 6 0 0 3 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 1 2 2 0 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 67 63 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 92 96 68
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 24 (6.32%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 57 (15.0%)
Isoleucine (Ile, I)
n = 43 (11.32%)
Methionine (Met, M)
n = 21 (5.53%)
Proline (Pro, P)
n = 22 (5.79%)
Phenylalanine (Phe, F)
n = 25 (6.58%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 23 17 5 12 32 3 5 5 1 2 8 6 0 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 1 7 15 1 2 5 16 1 3 5 14 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 5 2 13 0 1 2 5 10 1 0 3 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 4 7 9 1 0 0 8 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 100 118 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 89 79 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 133 173 63
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 19 17 7 9 28 2 8 7 0 1 4 7 1 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 10 17 0 1 4 5 2 6 6 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 0 4 12 1 2 2 6 7 0 3 7 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 2 1 7 0 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 85 95 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 88 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 88 156 59
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 41 (11.85%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 39 3 11 24 2 12 9 0 4 3 2 1 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 5 7 0 2 4 8 0 1 9 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 0 1 10 16 0 0 2 1 7 0 1 3 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 0 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 77 150 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 105 57 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 111 178 51
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 41 (11.85%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 39 3 11 24 2 12 9 0 4 3 2 1 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 5 7 0 2 4 8 0 1 9 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 0 1 10 16 0 0 2 1 7 0 1 3 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 0 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 77 150 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 105 57 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 111 178 51
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 18 31 9 15 48 2 17 11 0 3 5 9 0 16 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 2 10 14 1 1 7 10 0 2 8 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 0 5 13 11 0 4 7 5 11 1 3 8 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 1 2 11 0 1 3 5 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 126 156 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 111 84 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 141 215 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 10 2 3 12 0 4 2 0 2 0 3 2 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 3 5 0 0 1 3 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 4 2 4 0 0 0 1 3 0 1 3 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 23 26 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 18 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 22 48 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 36 (5.94%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 92 (15.18%)
Isoleucine (Ile, I)
n = 62 (10.23%)
Methionine (Met, M)
n = 36 (5.94%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 36 (5.94%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 10 (1.65%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 31 33 13 16 44 0 17 19 0 4 6 8 0 24 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 2 7 10 19 0 2 10 15 1 5 10 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 29 1 7 17 11 1 4 8 8 13 1 2 12 24 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 1 5 5 23 1 2 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 136 228 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 156 132 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 202 254 140
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 0 4 0 0 0 1 10 0 1 8 1 7 6 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 5 0 1 0 16 0 4 6 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 5 0 2 0 4 0 8 1 2 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 2 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 6 49 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 32 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 2 37 97
Total protein-coding genes (size: 11412 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 240 (6.31%)
Serine (Ser, S)
n = 278 (7.31%)
Threonine (Thr, T)
n = 312 (8.21%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 177 (4.66%)
Leucine (Leu, L)
n = 602 (15.84%)
Isoleucine (Ile, I)
n = 345 (9.08%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 240 (6.31%)
Tyrosine (Tyr, Y)
n = 138 (3.63%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 167 (4.39%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 90 (2.37%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
184 161 228 68 96 271 28 118 87 2 41 45 80 11 132 108
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
30 12 12 46 77 115 2 43 52 104 16 35 62 93 0 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
85 167 6 46 62 112 2 19 37 62 76 7 21 64 103 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 82 14 30 36 90 9 7 13 42 2 0 0 7 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
794 896 1237 875
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 964 753 1622
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
151 1079 1693 879

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.