Viewing data for Xenopeltis unicolor


Scientific name Xenopeltis unicolor
Common name Sunbeam snake
Maximum lifespan 12.10 years (Xenopeltis unicolor@AnAge)

Total mtDNA (size: 18872 bases) GC AT G C A T
Base content (bases) 7195 11677 4903 2292 4956 6721
Base content per 1 kb (bases) 381 619 260 121 263 356
Base content (%) 38.1% 61.9%
Total protein-coding genes (size: 11262 bases) GC AT G C A T
Base content (bases) 4498 6764 3210 1288 2856 3908
Base content per 1 kb (bases) 399 601 285 114 254 347
Base content (%) 39.9% 60.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1464 bases) GC AT G C A T
Base content (bases) 588 876 354 234 376 500
Base content per 1 kb (bases) 402 598 242 160 257 342
Base content (%) 40.2% 59.8%
Total rRNA-coding genes (size: 2484 bases) GC AT G C A T
Base content (bases) 1011 1473 604 407 529 944
Base content per 1 kb (bases) 407 593 243 164 213 380
Base content (%) 40.7% 59.3%
12S rRNA gene (size: 944 bases) GC AT G C A T
Base content (bases) 413 531 244 169 192 339
Base content per 1 kb (bases) 438 563 258 179 203 359
Base content (%) 43.8% 56.3%
16S rRNA gene (size: 1540 bases) GC AT G C A T
Base content (bases) 598 942 360 238 337 605
Base content per 1 kb (bases) 388 612 234 155 219 393
Base content (%) 38.8% 61.2%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 248 432 174 74 199 233
Base content per 1 kb (bases) 365 635 256 109 293 343
Base content (%) 36.5% 63.5%
ATP8 (size: 171 bases) GC AT G C A T
Base content (bases) 55 116 32 23 51 65
Base content per 1 kb (bases) 322 678 187 135 298 380
Base content (%) 32.2% 67.8%
COX1 (size: 1546 bases) GC AT G C A T
Base content (bases) 637 909 407 230 442 467
Base content per 1 kb (bases) 412 588 263 149 286 302
Base content (%) 41.2% 58.8%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 297 390 186 111 164 226
Base content per 1 kb (bases) 432 568 271 162 239 329
Base content (%) 43.2% 56.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 232 121 192 239
Base content per 1 kb (bases) 450 550 296 154 245 305
Base content (%) 45.0% 55.0%
CYTB (size: 1117 bases) GC AT G C A T
Base content (bases) 479 638 351 128 282 356
Base content per 1 kb (bases) 429 571 314 115 252 319
Base content (%) 42.9% 57.1%
ND1 (size: 964 bases) GC AT G C A T
Base content (bases) 389 575 284 105 250 325
Base content per 1 kb (bases) 404 596 295 109 259 337
Base content (%) 40.4% 59.6%
ND2 (size: 1032 bases) GC AT G C A T
Base content (bases) 392 640 305 87 236 404
Base content per 1 kb (bases) 380 620 296 84 229 391
Base content (%) 38.0% 62.0%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 130 213 92 38 100 113
Base content per 1 kb (bases) 379 621 268 111 292 329
Base content (%) 37.9% 62.1%
ND4 (size: 1356 bases) GC AT G C A T
Base content (bases) 544 812 406 138 340 472
Base content per 1 kb (bases) 401 599 299 102 251 348
Base content (%) 40.1% 59.9%
ND4L (size: 290 bases) GC AT G C A T
Base content (bases) 107 183 75 32 83 100
Base content per 1 kb (bases) 369 631 259 110 286 345
Base content (%) 36.9% 63.1%
ND5 (size: 1794 bases) GC AT G C A T
Base content (bases) 679 1115 509 170 437 678
Base content per 1 kb (bases) 378 622 284 95 244 378
Base content (%) 37.8% 62.2%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 190 323 158 32 85 238
Base content per 1 kb (bases) 370 630 308 62 166 464
Base content (%) 37.0% 63.0%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.11%)
Alanine (Ala, A)
n = 13 (5.78%)
Serine (Ser, S)
n = 16 (7.11%)
Threonine (Thr, T)
n = 25 (11.11%)
Cysteine (Cys, C)
n = 2 (0.89%)
Valine (Val, V)
n = 14 (6.22%)
Leucine (Leu, L)
n = 39 (17.33%)
Isoleucine (Ile, I)
n = 17 (7.56%)
Methionine (Met, M)
n = 23 (10.22%)
Proline (Pro, P)
n = 12 (5.33%)
Phenylalanine (Phe, F)
n = 14 (6.22%)
Tyrosine (Tyr, Y)
n = 4 (1.78%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 14 (6.22%)
Glutamine (Gln, Q)
n = 6 (2.67%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 3 (1.33%)
Arginine (Arg, R)
n = 5 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 20 4 6 19 4 6 4 2 2 2 9 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 3 5 0 0 2 5 0 1 0 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 3 1 7 0 0 5 1 3 0 0 6 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 0 1 0 2 1 0 1 4 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 59 87 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 61 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 54 109 51
ATP8 (size: 171 bases)
Amino acid sequence: MPQLDIVYIFTNYIWTWFILISLMWKIQTTLLSSGPEQDISMEDLEAELAWILPWM*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.79%)
Alanine (Ala, A)
n = 2 (3.57%)
Serine (Ser, S)
n = 4 (7.14%)
Threonine (Thr, T)
n = 4 (7.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.79%)
Leucine (Leu, L)
n = 8 (14.29%)
Isoleucine (Ile, I)
n = 8 (14.29%)
Methionine (Met, M)
n = 4 (7.14%)
Proline (Pro, P)
n = 3 (5.36%)
Phenylalanine (Phe, F)
n = 2 (3.57%)
Tyrosine (Tyr, Y)
n = 2 (3.57%)
Tryptophan (Trp, W)
n = 5 (8.93%)
Aspartic acid (Asp, D)
n = 3 (5.36%)
Glutamic acid (Glu, E)
n = 4 (7.14%)
Asparagine (Asn, N)
n = 1 (1.79%)
Glutamine (Gln, Q)
n = 3 (5.36%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (1.79%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 3 3 1 1 3 0 3 3 0 0 0 0 1 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 1 0 0 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 0 1 1 1 1 1 1 1 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 2 1 1 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 11 20 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 11 15 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 10 30 13
COX1 (size: 1546 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.75%)
Alanine (Ala, A)
n = 34 (6.61%)
Serine (Ser, S)
n = 34 (6.61%)
Threonine (Thr, T)
n = 43 (8.37%)
Cysteine (Cys, C)
n = 4 (0.78%)
Valine (Val, V)
n = 33 (6.42%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 45 (8.75%)
Methionine (Met, M)
n = 29 (5.64%)
Proline (Pro, P)
n = 31 (6.03%)
Phenylalanine (Phe, F)
n = 46 (8.95%)
Tyrosine (Tyr, Y)
n = 15 (2.92%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 13 (2.53%)
Glutamic acid (Glu, E)
n = 6 (1.17%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 16 (3.11%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 25 29 7 7 29 6 10 8 0 8 9 13 3 25 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 2 7 12 14 1 5 12 21 7 3 5 22 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 24 1 5 5 18 0 0 6 6 9 0 0 5 14 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 7 6 10 0 1 0 7 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
131 112 152 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 136 87 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 159 228 109
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 19 (8.33%)
Serine (Ser, S)
n = 12 (5.26%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 24 (10.53%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 10 (4.39%)
Methionine (Met, M)
n = 10 (4.39%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 17 (7.46%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 10 (4.39%)
Histidine (His, H)
n = 7 (3.07%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 7 9 5 4 9 2 5 9 1 6 5 12 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 12 5 0 0 4 5 0 4 0 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 3 2 5 1 1 0 5 3 0 2 1 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 16 1 4 5 2 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 57 52 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 64 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 66 110 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 21 (8.08%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 20 (7.69%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 6 (2.31%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 11 9 2 5 21 4 2 6 0 5 6 10 0 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 9 5 0 1 8 8 2 1 2 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 1 4 6 1 0 4 3 8 1 0 2 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 2 3 1 6 0 0 3 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 68 67 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 64 57 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 100 115 33
CYTB (size: 1117 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.12%)
Alanine (Ala, A)
n = 28 (7.55%)
Serine (Ser, S)
n = 23 (6.2%)
Threonine (Thr, T)
n = 37 (9.97%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 16 (4.31%)
Leucine (Leu, L)
n = 49 (13.21%)
Isoleucine (Ile, I)
n = 33 (8.89%)
Methionine (Met, M)
n = 16 (4.31%)
Proline (Pro, P)
n = 24 (6.47%)
Phenylalanine (Phe, F)
n = 31 (8.36%)
Tyrosine (Tyr, Y)
n = 14 (3.77%)
Tryptophan (Trp, W)
n = 12 (3.23%)
Aspartic acid (Asp, D)
n = 8 (2.16%)
Glutamic acid (Glu, E)
n = 6 (1.62%)
Asparagine (Asn, N)
n = 17 (4.58%)
Glutamine (Gln, Q)
n = 7 (1.89%)
Histidine (His, H)
n = 15 (4.04%)
Lysine (Lys, K)
n = 9 (2.43%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 15 7 9 25 0 8 6 1 2 7 5 2 12 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 16 11 1 1 6 11 1 1 6 17 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 1 1 5 14 0 0 3 4 10 2 0 2 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 0 8 9 0 1 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 93 115 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 109 76 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 149 165 49
ND1 (size: 964 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.63%)
Alanine (Ala, A)
n = 22 (6.88%)
Serine (Ser, S)
n = 24 (7.5%)
Threonine (Thr, T)
n = 28 (8.75%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 9 (2.81%)
Leucine (Leu, L)
n = 57 (17.81%)
Isoleucine (Ile, I)
n = 20 (6.25%)
Methionine (Met, M)
n = 28 (8.75%)
Proline (Pro, P)
n = 27 (8.44%)
Phenylalanine (Phe, F)
n = 18 (5.63%)
Tyrosine (Tyr, Y)
n = 12 (3.75%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 12 (3.75%)
Glutamine (Gln, Q)
n = 8 (2.5%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 8 (2.5%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 11 27 4 5 34 0 13 8 0 2 2 4 1 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 12 8 0 3 8 7 0 5 3 19 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 2 2 9 11 1 0 1 5 7 0 1 0 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 1 0 3 8 0 0 1 5 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 86 97 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 100 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 98 174 41
ND2 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.21%)
Alanine (Ala, A)
n = 25 (7.29%)
Serine (Ser, S)
n = 29 (8.45%)
Threonine (Thr, T)
n = 56 (16.33%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 53 (15.45%)
Isoleucine (Ile, I)
n = 35 (10.2%)
Methionine (Met, M)
n = 36 (10.5%)
Proline (Pro, P)
n = 17 (4.96%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 7 (2.04%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 12 (3.5%)
Glutamine (Gln, Q)
n = 8 (2.33%)
Histidine (His, H)
n = 7 (2.04%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 23 34 3 7 35 1 7 8 0 0 1 3 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 10 12 1 0 3 6 2 2 3 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 30 0 0 5 17 2 0 5 2 5 0 0 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 0 12 0 0 1 2 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 82 156 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 122 54 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 101 194 40
ND3 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.21%)
Alanine (Ala, A)
n = 25 (7.29%)
Serine (Ser, S)
n = 29 (8.45%)
Threonine (Thr, T)
n = 56 (16.33%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 53 (15.45%)
Isoleucine (Ile, I)
n = 35 (10.2%)
Methionine (Met, M)
n = 36 (10.5%)
Proline (Pro, P)
n = 17 (4.96%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 7 (2.04%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 12 (3.5%)
Glutamine (Gln, Q)
n = 8 (2.33%)
Histidine (His, H)
n = 7 (2.04%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 23 34 3 7 35 1 7 8 0 0 1 3 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 10 12 1 0 3 6 2 2 3 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 30 0 0 5 17 2 0 5 2 5 0 0 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 0 12 0 0 1 2 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 82 156 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 122 54 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 101 194 40
ND4 (size: 1356 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.33%)
Alanine (Ala, A)
n = 39 (8.65%)
Serine (Ser, S)
n = 32 (7.1%)
Threonine (Thr, T)
n = 49 (10.86%)
Cysteine (Cys, C)
n = 5 (1.11%)
Valine (Val, V)
n = 4 (0.89%)
Leucine (Leu, L)
n = 85 (18.85%)
Isoleucine (Ile, I)
n = 44 (9.76%)
Methionine (Met, M)
n = 37 (8.2%)
Proline (Pro, P)
n = 27 (5.99%)
Phenylalanine (Phe, F)
n = 18 (3.99%)
Tyrosine (Tyr, Y)
n = 10 (2.22%)
Tryptophan (Trp, W)
n = 10 (2.22%)
Aspartic acid (Asp, D)
n = 4 (0.89%)
Glutamic acid (Glu, E)
n = 8 (1.77%)
Asparagine (Asn, N)
n = 18 (3.99%)
Glutamine (Gln, Q)
n = 14 (3.1%)
Histidine (His, H)
n = 12 (2.66%)
Lysine (Lys, K)
n = 11 (2.44%)
Arginine (Arg, R)
n = 9 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 30 32 10 12 44 4 15 11 3 0 0 4 0 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 4 17 15 3 1 7 5 2 2 0 24 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 1 2 4 20 0 0 6 3 7 1 0 5 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 0 2 2 11 0 1 1 6 1 0 1 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 132 166 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 141 77 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 133 229 68
ND4L (size: 290 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.21%)
Alanine (Ala, A)
n = 6 (6.32%)
Serine (Ser, S)
n = 7 (7.37%)
Threonine (Thr, T)
n = 12 (12.63%)
Cysteine (Cys, C)
n = 2 (2.11%)
Valine (Val, V)
n = 6 (6.32%)
Leucine (Leu, L)
n = 19 (20.0%)
Isoleucine (Ile, I)
n = 9 (9.47%)
Methionine (Met, M)
n = 10 (10.53%)
Proline (Pro, P)
n = 2 (2.11%)
Phenylalanine (Phe, F)
n = 4 (4.21%)
Tyrosine (Tyr, Y)
n = 1 (1.05%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.05%)
Glutamic acid (Glu, E)
n = 2 (2.11%)
Asparagine (Asn, N)
n = 2 (2.11%)
Glutamine (Gln, Q)
n = 1 (1.05%)
Histidine (His, H)
n = 4 (4.21%)
Lysine (Lys, K)
n = 3 (3.16%)
Arginine (Arg, R)
n = 1 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 9 3 2 11 1 2 1 0 0 1 5 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 2 2 0 0 1 2 1 0 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 0 1 3 1 1 1 0 1 0 0 1 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 3 0 0 0 1 0 0 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 25 38 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 25 14 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 25 47 20
ND5 (size: 1794 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.02%)
Alanine (Ala, A)
n = 41 (6.87%)
Serine (Ser, S)
n = 47 (7.87%)
Threonine (Thr, T)
n = 82 (13.74%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 13 (2.18%)
Leucine (Leu, L)
n = 80 (13.4%)
Isoleucine (Ile, I)
n = 69 (11.56%)
Methionine (Met, M)
n = 43 (7.2%)
Proline (Pro, P)
n = 23 (3.85%)
Phenylalanine (Phe, F)
n = 28 (4.69%)
Tyrosine (Tyr, Y)
n = 13 (2.18%)
Tryptophan (Trp, W)
n = 9 (1.51%)
Aspartic acid (Asp, D)
n = 10 (1.68%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 32 (5.36%)
Glutamine (Gln, Q)
n = 21 (3.52%)
Histidine (His, H)
n = 16 (2.68%)
Lysine (Lys, K)
n = 24 (4.02%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 38 42 7 15 38 5 15 18 3 4 2 7 0 13 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 15 20 2 2 7 13 2 1 3 19 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 46 1 2 14 20 0 0 11 9 4 0 0 10 22 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 1 2 8 23 1 0 2 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 133 261 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 182 129 233
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 194 288 100
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.94%)
Alanine (Ala, A)
n = 5 (2.94%)
Serine (Ser, S)
n = 9 (5.29%)
Threonine (Thr, T)
n = 5 (2.94%)
Cysteine (Cys, C)
n = 9 (5.29%)
Valine (Val, V)
n = 36 (21.18%)
Leucine (Leu, L)
n = 22 (12.94%)
Isoleucine (Ile, I)
n = 9 (5.29%)
Methionine (Met, M)
n = 6 (3.53%)
Proline (Pro, P)
n = 2 (1.18%)
Phenylalanine (Phe, F)
n = 13 (7.65%)
Tyrosine (Tyr, Y)
n = 9 (5.29%)
Tryptophan (Trp, W)
n = 5 (2.94%)
Aspartic acid (Asp, D)
n = 5 (2.94%)
Glutamic acid (Glu, E)
n = 3 (1.76%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 1 (0.59%)
Lysine (Lys, K)
n = 3 (1.76%)
Arginine (Arg, R)
n = 3 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 3 2 0 0 2 7 0 1 19 0 7 10 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 9 0 4 0 0 1 9 1 4 8 0 0 1 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 5 0 1 0 3 0 8 1 0 11 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 5 0 0 3 1 0 1 1 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 11 29 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 18 24 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 3 32 92
Total protein-coding genes (size: 11277 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 199 (5.3%)
Alanine (Ala, A)
n = 252 (6.71%)
Serine (Ser, S)
n = 258 (6.87%)
Threonine (Thr, T)
n = 398 (10.6%)
Cysteine (Cys, C)
n = 32 (0.85%)
Valine (Val, V)
n = 187 (4.98%)
Leucine (Leu, L)
n = 555 (14.78%)
Isoleucine (Ile, I)
n = 327 (8.71%)
Methionine (Met, M)
n = 259 (6.9%)
Proline (Pro, P)
n = 201 (5.35%)
Phenylalanine (Phe, F)
n = 217 (5.78%)
Tyrosine (Tyr, Y)
n = 110 (2.93%)
Tryptophan (Trp, W)
n = 99 (2.64%)
Aspartic acid (Asp, D)
n = 68 (1.81%)
Glutamic acid (Glu, E)
n = 92 (2.45%)
Asparagine (Asn, N)
n = 147 (3.91%)
Glutamine (Gln, Q)
n = 95 (2.53%)
Histidine (His, H)
n = 97 (2.58%)
Lysine (Lys, K)
n = 95 (2.53%)
Arginine (Arg, R)
n = 62 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
136 191 237 58 76 282 29 96 84 11 49 38 81 19 106 111
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 13 19 33 109 101 9 22 62 90 25 20 23 154 4 59
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 209 9 24 52 125 7 6 44 49 61 6 14 39 108 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 85 7 31 37 89 6 4 10 44 4 1 1 4 0 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
798 900 1278 780
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
444 1059 708 1545
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
173 1126 1775 682

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.