Viewing data for Aythya ferina


Scientific name Aythya ferina
Common name Common pochard
Maximum lifespan 23.20 years (Aythya ferina@AnAge)

Total mtDNA (size: 16616 bases) GC AT G C A T
Base content (bases) 8041 8575 5455 2586 3687 4888
Base content per 1 kb (bases) 484 516 328 156 222 294
Base content (%) 48.4% 51.6%
Total protein-coding genes (size: 11387 bases) GC AT G C A T
Base content (bases) 5635 5752 4001 1634 2536 3216
Base content per 1 kb (bases) 495 505 351 143 223 282
Base content (%) 49.5% 50.5%
D-loop (size: 1055 bases) GC AT G C A T
Base content (bases) 501 554 340 161 258 296
Base content per 1 kb (bases) 475 525 322 153 245 281
Base content (%) 47.5% 52.5%
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 674 868 395 279 381 487
Base content per 1 kb (bases) 437 563 256 181 247 316
Base content (%) 43.7% 56.3%
Total rRNA-coding genes (size: 2586 bases) GC AT G C A T
Base content (bases) 1207 1379 696 511 500 879
Base content per 1 kb (bases) 467 533 269 198 193 340
Base content (%) 46.7% 53.3%
12S rRNA gene (size: 982 bases) GC AT G C A T
Base content (bases) 475 507 277 198 187 320
Base content per 1 kb (bases) 484 516 282 202 190 326
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1604 bases) GC AT G C A T
Base content (bases) 732 872 419 313 313 559
Base content per 1 kb (bases) 456 544 261 195 195 349
Base content (%) 45.6% 54.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 330 354 253 77 159 195
Base content per 1 kb (bases) 482 518 370 113 232 285
Base content (%) 48.2% 51.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 81 87 67 14 31 56
Base content per 1 kb (bases) 482 518 399 83 185 333
Base content (%) 48.2% 51.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 784 767 518 266 366 401
Base content per 1 kb (bases) 505 495 334 172 236 259
Base content (%) 50.5% 49.5%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 341 346 226 115 153 193
Base content per 1 kb (bases) 496 504 329 167 223 281
Base content (%) 49.6% 50.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 393 391 266 127 180 211
Base content per 1 kb (bases) 501 499 339 162 230 269
Base content (%) 50.1% 49.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 577 566 410 167 265 301
Base content per 1 kb (bases) 505 495 359 146 232 263
Base content (%) 50.5% 49.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 488 490 334 154 241 249
Base content per 1 kb (bases) 499 501 342 157 246 255
Base content (%) 49.9% 50.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 503 536 371 132 232 304
Base content per 1 kb (bases) 484 516 357 127 223 293
Base content (%) 48.4% 51.6%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 177 175 122 55 85 90
Base content per 1 kb (bases) 503 497 347 156 241 256
Base content (%) 50.3% 49.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 660 718 494 166 315 403
Base content per 1 kb (bases) 479 521 358 120 229 292
Base content (%) 47.9% 52.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 100 49 73 75
Base content per 1 kb (bases) 502 498 337 165 246 253
Base content (%) 50.2% 49.8%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 894 930 642 252 389 541
Base content per 1 kb (bases) 490 510 352 138 213 297
Base content (%) 49.0% 51.0%
ND6 (size: 521 bases) GC AT G C A T
Base content (bases) 263 258 201 62 51 207
Base content per 1 kb (bases) 505 495 386 119 98 397
Base content (%) 50.5% 49.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 7 7 14 30 5 5 6 1 0 5 2 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 10 4 0 1 4 3 0 1 8 6 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 2 1 6 4 0 0 5 1 3 3 0 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 1 0 0 5 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 89 69 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 35 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 99 91 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLTFTTTNPPSSKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 1 0 4 2 2 0 1 1 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 2 0 0 0 0 0 1 3 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 0 1 2 0 0 1 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 20 22 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 26 8 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 21 26 4
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.4%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 32 20 3 18 29 6 5 6 4 4 12 13 4 7 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 5 32 9 0 3 18 19 7 6 12 9 3 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 0 4 10 9 1 0 3 3 14 2 2 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 8 2 1 14 8 1 0 1 6 1 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 123 135 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 256 171 52
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.33%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 5 2 10 13 2 2 7 0 5 3 9 2 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 9 3 0 0 4 3 2 0 6 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 0 2 7 6 3 0 3 0 8 1 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 3 2 11 2 2 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 63 49 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 103 82 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 13 7 0 11 14 3 3 5 1 0 7 7 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 12 7 0 0 9 8 2 2 3 6 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 1 6 5 1 1 4 1 8 1 1 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 6 2 1 4 4 0 0 0 3 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 69 60 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 127 97 21
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 26 6 4 18 28 11 2 6 2 1 6 9 2 4 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 5 1 21 8 0 0 9 9 5 2 10 10 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 6 1 2 8 11 2 0 2 3 10 1 0 2 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 2 0 7 9 1 0 2 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 113 97 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 194 126 28
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 17 (5.23%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 19 (5.85%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 18 (5.54%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 17 14 5 16 29 8 2 3 3 3 7 6 3 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 17 7 1 1 4 3 6 4 14 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 2 4 8 10 1 0 6 1 13 0 1 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 5 2 0 1 7 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 99 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 140 114 35
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 36 (10.43%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 14 (4.06%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 11 6 16 32 8 3 4 5 0 8 5 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 7 16 13 0 0 6 1 4 3 7 13 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 4 13 8 1 1 7 1 6 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 13 1 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 108 112 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 121 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 142 135 37
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 36 (10.43%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 14 (4.06%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 11 6 16 32 8 3 4 5 0 8 5 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 7 16 13 0 0 6 1 4 3 7 13 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 4 13 8 1 1 7 1 6 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 13 1 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 108 112 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 121 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 142 135 37
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 47 (10.26%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 29 14 7 25 49 15 6 11 1 0 4 5 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 3 5 17 8 2 0 9 11 0 2 12 12 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 21 0 3 13 14 0 0 9 2 11 2 0 2 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 2 9 1 1 2 8 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 163 144 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 137 73 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 194 186 42
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 4 1 3 8 5 1 2 0 0 1 4 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 5 2 0 2 2 1 1 0 3 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 3 4 1 0 3 0 1 1 0 0 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 31 25 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 27 17 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 42 33 12
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.27%)
Alanine (Ala, A)
n = 62 (10.21%)
Serine (Ser, S)
n = 37 (6.1%)
Threonine (Thr, T)
n = 64 (10.54%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 20 (3.29%)
Leucine (Leu, L)
n = 107 (17.63%)
Isoleucine (Ile, I)
n = 48 (7.91%)
Methionine (Met, M)
n = 30 (4.94%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 34 (5.6%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 25 (4.12%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 16 (2.64%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 38 23 6 29 54 11 6 14 5 1 4 13 2 7 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 7 5 36 18 3 0 12 14 6 1 13 15 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 19 0 2 18 7 1 0 9 0 11 4 1 4 21 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 11 3 0 6 19 4 0 4 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 175 199 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 185 115 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 282 227 50
ND6 (size: 521 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.12%)
Alanine (Ala, A)
n = 18 (10.47%)
Serine (Ser, S)
n = 11 (6.4%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 36 (20.93%)
Leucine (Leu, L)
n = 26 (15.12%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 14 (8.14%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 3 1 1 5 4 0 0 19 1 7 9 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 3 2 5 8 6 1 1 18 3 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 1 3 3 0 7 0 4 12 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 1 0 0 1 0 1 4 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 20 15 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 34 14 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 8 21 71
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.79%)
Alanine (Ala, A)
n = 333 (8.77%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 195 (5.13%)
Leucine (Leu, L)
n = 666 (17.53%)
Isoleucine (Ile, I)
n = 278 (7.32%)
Methionine (Met, M)
n = 172 (4.53%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 223 (5.87%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 120 (3.16%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
70 208 116 45 173 305 86 39 67 25 33 58 80 24 52 171
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 2 27 44 185 90 14 13 79 77 51 27 93 94 17 31
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
153 120 6 27 95 85 15 6 52 19 87 22 18 17 103 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
99 71 24 7 54 76 13 2 16 47 8 0 2 7 0 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
904 1116 1029 751
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
489 1096 681 1534
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
381 1653 1359 407

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.