Viewing data for Chelydra serpentina


Scientific name Chelydra serpentina
Common name Common snapping turtle
Maximum lifespan 47.00 years (Chelydra serpentina@AnAge)

Total mtDNA (size: 16631 bases) GC AT G C A T
Base content (bases) 6271 10360 4174 2097 4634 5726
Base content per 1 kb (bases) 377 623 251 126 279 344
Base content (%) 37.7% 62.3%
Total protein-coding genes (size: 11358 bases) GC AT G C A T
Base content (bases) 4317 7041 3020 1297 3196 3845
Base content per 1 kb (bases) 380 620 266 114 281 339
Base content (%) 38.0% 62.0%
D-loop (size: 1125 bases) GC AT G C A T
Base content (bases) 344 781 209 135 417 364
Base content per 1 kb (bases) 306 694 186 120 371 324
Base content (%) 30.6% 69.4%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 590 956 351 239 416 540
Base content per 1 kb (bases) 382 618 227 155 269 349
Base content (%) 38.2% 61.8%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1008 1563 585 423 593 970
Base content per 1 kb (bases) 392 608 228 165 231 377
Base content (%) 39.2% 60.8%
12S rRNA gene (size: 965 bases) GC AT G C A T
Base content (bases) 408 557 244 164 210 347
Base content per 1 kb (bases) 423 577 253 170 218 360
Base content (%) 42.3% 57.7%
16S rRNA gene (size: 1606 bases) GC AT G C A T
Base content (bases) 600 1006 341 259 383 623
Base content per 1 kb (bases) 374 626 212 161 238 388
Base content (%) 37.4% 62.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 254 430 193 61 190 240
Base content per 1 kb (bases) 371 629 282 89 278 351
Base content (%) 37.1% 62.9%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 56 109 49 7 43 66
Base content per 1 kb (bases) 339 661 297 42 261 400
Base content (%) 33.9% 66.1%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 604 944 352 252 479 465
Base content per 1 kb (bases) 390 610 227 163 309 300
Base content (%) 39.0% 61.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 236 448 149 87 202 246
Base content per 1 kb (bases) 345 655 218 127 295 360
Base content (%) 34.5% 65.5%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 330 455 213 117 220 235
Base content per 1 kb (bases) 420 580 271 149 280 299
Base content (%) 42.0% 58.0%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 470 674 338 132 319 355
Base content per 1 kb (bases) 411 589 295 115 279 310
Base content (%) 41.1% 58.9%
ND1 (size: 970 bases) GC AT G C A T
Base content (bases) 368 602 257 111 297 305
Base content per 1 kb (bases) 379 621 265 114 306 314
Base content (%) 37.9% 62.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 374 665 286 88 277 388
Base content per 1 kb (bases) 360 640 275 85 267 373
Base content (%) 36.0% 64.0%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 135 215 94 41 106 109
Base content per 1 kb (bases) 386 614 269 117 303 311
Base content (%) 38.6% 61.4%
ND4 (size: 1384 bases) GC AT G C A T
Base content (bases) 495 889 357 138 395 494
Base content per 1 kb (bases) 358 642 258 100 285 357
Base content (%) 35.8% 64.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 181 87 29 96 85
Base content per 1 kb (bases) 391 609 293 98 323 286
Base content (%) 39.1% 60.9%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 689 1117 498 191 493 624
Base content per 1 kb (bases) 382 618 276 106 273 346
Base content (%) 38.2% 61.8%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 197 328 152 45 84 244
Base content per 1 kb (bases) 375 625 290 86 160 465
Base content (%) 37.5% 62.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 32 (14.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 50 (22.03%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 12 (5.29%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 14 6 4 14 3 22 12 0 2 1 4 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 2 4 0 1 3 4 0 1 3 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 0 3 4 4 0 0 3 0 3 0 1 2 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 3 0 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 63 81 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 70 38 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 60 121 40
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFLILSSAWLIYTLLLQPNIMSYMSMNKPTNKNKITNTNPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 4 (7.41%)
Threonine (Thr, T)
n = 6 (11.11%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.96%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 4 (7.41%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 8 (14.81%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 3 1 1 4 0 1 2 0 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 2 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 1 2 1 0 0 0 1 1 0 0 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 15 25 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 16 25 13
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 44 (8.54%)
Serine (Ser, S)
n = 31 (6.02%)
Threonine (Thr, T)
n = 39 (7.57%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.18%)
Leucine (Leu, L)
n = 58 (11.26%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 33 (6.41%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 39 (7.57%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 11 30 9 1 25 3 19 8 1 10 2 22 3 23 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 10 16 18 0 11 9 21 6 3 8 14 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 0 5 7 15 0 3 1 12 7 2 1 6 8 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 7 8 9 0 2 1 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 101 139 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 96 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 115 230 150
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 11 (4.85%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 25 (11.01%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 20 (8.81%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 3 19 3 3 8 2 9 8 0 3 1 8 2 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 2 5 0 2 0 4 2 2 2 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 4 1 7 0 2 0 4 6 1 0 5 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 0 6 4 3 0 1 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 54 70 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 41 112 67
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 9 2 5 14 0 12 7 1 1 2 10 3 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 4 11 5 0 3 6 10 1 2 2 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 0 3 7 0 1 3 7 5 0 1 2 2 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 1 3 2 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 62 60 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 53 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 82 121 51
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.84%)
Alanine (Ala, A)
n = 21 (5.53%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 33 (8.68%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.95%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 36 (9.47%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 24 10 12 8 20 5 19 9 0 1 3 11 0 6 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 3 11 7 0 8 8 10 0 2 5 16 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 12 0 3 3 15 0 0 1 3 12 0 0 5 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 3 6 10 0 0 1 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 96 112 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 98 80 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 144 163 68
ND1 (size: 970 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 21 (6.52%)
Serine (Ser, S)
n = 30 (9.32%)
Threonine (Thr, T)
n = 17 (5.28%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.04%)
Leucine (Leu, L)
n = 64 (19.88%)
Isoleucine (Ile, I)
n = 21 (6.52%)
Methionine (Met, M)
n = 21 (6.52%)
Proline (Pro, P)
n = 23 (7.14%)
Phenylalanine (Phe, F)
n = 22 (6.83%)
Tyrosine (Tyr, Y)
n = 14 (4.35%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 14 (4.35%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 18 9 3 28 0 24 6 0 2 1 8 2 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 3 14 4 0 2 3 9 2 3 4 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 0 4 8 16 1 0 1 7 7 1 0 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 3 8 0 0 0 6 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 78 82 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 59 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 89 164 57
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 25 (7.25%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 39 (11.3%)
Methionine (Met, M)
n = 32 (9.28%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 14 (4.06%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 30 7 4 28 1 16 13 1 1 0 3 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 12 8 0 1 3 8 1 4 5 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 1 4 7 9 0 1 4 4 4 0 2 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 83 148 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 109 59 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 94 181 63
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 25 (7.25%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 39 (11.3%)
Methionine (Met, M)
n = 32 (9.28%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 14 (4.06%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 30 7 4 28 1 16 13 1 1 0 3 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 12 8 0 1 3 8 1 4 5 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 1 4 7 9 0 1 4 4 4 0 2 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 83 148 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 109 59 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 94 181 63
ND4 (size: 1384 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.57%)
Alanine (Ala, A)
n = 28 (6.09%)
Serine (Ser, S)
n = 35 (7.61%)
Threonine (Thr, T)
n = 52 (11.3%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 10 (2.17%)
Leucine (Leu, L)
n = 86 (18.7%)
Isoleucine (Ile, I)
n = 41 (8.91%)
Methionine (Met, M)
n = 38 (8.26%)
Proline (Pro, P)
n = 22 (4.78%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 16 (3.48%)
Tryptophan (Trp, W)
n = 15 (3.26%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 9 (1.96%)
Asparagine (Asn, N)
n = 16 (3.48%)
Glutamine (Gln, Q)
n = 16 (3.48%)
Histidine (His, H)
n = 11 (2.39%)
Lysine (Lys, K)
n = 12 (2.61%)
Arginine (Arg, R)
n = 9 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 15 36 9 6 40 3 28 14 2 2 0 7 1 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 4 14 10 0 5 6 10 0 2 3 17 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 24 0 4 4 19 1 2 5 10 6 1 0 7 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 0 2 12 0 0 2 6 1 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 116 166 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 130 82 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 111 246 93
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 16 (16.33%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 6 3 0 9 1 8 3 0 0 0 1 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 6 0 0 1 2 0 0 3 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 3 10 0 1 2 1 1 1 0 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 0 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
14 26 25 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 30 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 31 44 21
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.66%)
Alanine (Ala, A)
n = 44 (7.32%)
Serine (Ser, S)
n = 43 (7.15%)
Threonine (Thr, T)
n = 60 (9.98%)
Cysteine (Cys, C)
n = 9 (1.5%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 95 (15.81%)
Isoleucine (Ile, I)
n = 54 (8.99%)
Methionine (Met, M)
n = 48 (7.99%)
Proline (Pro, P)
n = 32 (5.32%)
Phenylalanine (Phe, F)
n = 31 (5.16%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 11 (1.83%)
Asparagine (Asn, N)
n = 28 (4.66%)
Glutamine (Gln, Q)
n = 17 (2.83%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 25 (4.16%)
Arginine (Arg, R)
n = 11 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 25 45 13 12 44 1 24 17 0 1 7 6 1 14 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 4 6 22 15 1 6 10 11 1 4 8 19 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 26 2 5 9 19 0 2 8 11 6 0 1 8 20 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 5 5 24 1 2 1 6 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 143 225 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 169 122 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 186 277 124
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.64%)
Alanine (Ala, A)
n = 12 (6.9%)
Serine (Ser, S)
n = 14 (8.05%)
Threonine (Thr, T)
n = 4 (2.3%)
Cysteine (Cys, C)
n = 5 (2.87%)
Valine (Val, V)
n = 26 (14.94%)
Leucine (Leu, L)
n = 20 (11.49%)
Isoleucine (Ile, I)
n = 8 (4.6%)
Methionine (Met, M)
n = 8 (4.6%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 20 (11.49%)
Tyrosine (Tyr, Y)
n = 12 (6.9%)
Tryptophan (Trp, W)
n = 7 (4.02%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 3 (1.72%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 2 (1.15%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 0 2 2 0 1 0 10 0 1 12 1 3 10 20 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 5 0 4 0 7 1 8 1 2 11 1 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 6 1 2 0 5 0 10 2 3 7 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 0 0 0 3 0 0 0 0 1 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 12 27 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 28 22 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 5 35 92
Total protein-coding genes (size: 11380 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.7%)
Alanine (Ala, A)
n = 251 (6.62%)
Serine (Ser, S)
n = 267 (7.04%)
Threonine (Thr, T)
n = 346 (9.13%)
Cysteine (Cys, C)
n = 32 (0.84%)
Valine (Val, V)
n = 163 (4.3%)
Leucine (Leu, L)
n = 610 (16.09%)
Isoleucine (Ile, I)
n = 307 (8.1%)
Methionine (Met, M)
n = 254 (6.7%)
Proline (Pro, P)
n = 208 (5.49%)
Phenylalanine (Phe, F)
n = 223 (5.88%)
Tyrosine (Tyr, Y)
n = 133 (3.51%)
Tryptophan (Trp, W)
n = 112 (2.96%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 88 (2.32%)
Asparagine (Asn, N)
n = 143 (3.77%)
Glutamine (Gln, Q)
n = 107 (2.82%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
175 132 228 78 53 244 20 201 101 6 36 18 86 23 105 118
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 17 15 49 112 88 2 49 53 89 25 29 43 133 3 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
126 152 4 40 54 126 2 17 28 70 63 10 14 48 95 44
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 82 6 27 36 89 1 8 7 51 4 0 2 5 0 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
781 881 1187 942
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 1027 730 1557
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
148 1010 1777 856

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.