Viewing data for Balaenoptera edeni


Scientific name Balaenoptera edeni
Common name Bryde's whale
Maximum lifespan 72.00 years (Balaenoptera edeni@AnAge)

Total mtDNA (size: 16409 bases) GC AT G C A T
Base content (bases) 6645 9764 4525 2120 4363 5401
Base content per 1 kb (bases) 405 595 276 129 266 329
Base content (%) 40.5% 59.5%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4695 6655 3400 1295 3024 3631
Base content per 1 kb (bases) 414 586 300 114 266 320
Base content (%) 41.4% 58.6%
D-loop (size: 936 bases) GC AT G C A T
Base content (bases) 359 577 221 138 293 284
Base content per 1 kb (bases) 384 616 236 147 313 303
Base content (%) 38.4% 61.6%
Total tRNA-coding genes (size: 1522 bases) GC AT G C A T
Base content (bases) 560 962 328 232 425 537
Base content per 1 kb (bases) 368 632 216 152 279 353
Base content (%) 36.8% 63.2%
Total rRNA-coding genes (size: 2553 bases) GC AT G C A T
Base content (bases) 1008 1545 561 447 612 933
Base content per 1 kb (bases) 395 605 220 175 240 365
Base content (%) 39.5% 60.5%
12S rRNA gene (size: 975 bases) GC AT G C A T
Base content (bases) 410 565 233 177 215 350
Base content per 1 kb (bases) 421 579 239 182 221 359
Base content (%) 42.1% 57.9%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 598 980 328 270 397 583
Base content per 1 kb (bases) 379 621 208 171 252 369
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 266 415 198 68 201 214
Base content per 1 kb (bases) 391 609 291 100 295 314
Base content (%) 39.1% 60.9%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 66 126 55 11 55 71
Base content per 1 kb (bases) 344 656 286 57 286 370
Base content (%) 34.4% 65.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 654 897 402 252 450 447
Base content per 1 kb (bases) 422 578 259 162 290 288
Base content (%) 42.2% 57.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 273 411 183 90 175 236
Base content per 1 kb (bases) 399 601 268 132 256 345
Base content (%) 39.9% 60.1%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 342 444 234 108 221 223
Base content per 1 kb (bases) 435 565 298 137 281 284
Base content (%) 43.5% 56.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 507 633 358 149 289 344
Base content per 1 kb (bases) 445 555 314 131 254 302
Base content (%) 44.5% 55.5%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 395 562 292 103 249 313
Base content per 1 kb (bases) 413 587 305 108 260 327
Base content (%) 41.3% 58.7%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 401 643 321 80 264 379
Base content per 1 kb (bases) 384 616 307 77 253 363
Base content (%) 38.4% 61.6%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 152 195 110 42 88 107
Base content per 1 kb (bases) 438 562 317 121 254 308
Base content (%) 43.8% 56.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 571 807 431 140 370 437
Base content per 1 kb (bases) 414 586 313 102 269 317
Base content (%) 41.4% 58.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 130 167 91 39 86 81
Base content per 1 kb (bases) 438 562 306 131 290 273
Base content (%) 43.8% 56.2%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 752 1069 569 183 492 577
Base content per 1 kb (bases) 413 587 312 100 270 317
Base content (%) 41.3% 58.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 202 326 166 36 103 223
Base content per 1 kb (bases) 383 617 314 68 195 422
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 15 10 10 4 17 2 9 8 0 1 1 7 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 2 0 2 3 4 0 5 4 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 2 3 4 0 2 2 0 2 1 0 6 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 1 1 0 4 1 2 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 65 87 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 67 88 62
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMFLALFMLFQLKISKHSYSPSPKLVFTKTQKQQTPWNTTWTKIYLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.59%)
Serine (Ser, S)
n = 6 (9.52%)
Threonine (Thr, T)
n = 9 (14.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.59%)
Leucine (Leu, L)
n = 12 (19.05%)
Isoleucine (Ile, I)
n = 3 (4.76%)
Methionine (Met, M)
n = 3 (4.76%)
Proline (Pro, P)
n = 5 (7.94%)
Phenylalanine (Phe, F)
n = 4 (6.35%)
Tyrosine (Tyr, Y)
n = 2 (3.17%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.59%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 1 (1.59%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 2 2 2 0 5 5 0 0 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 2 2 0 0 1 1 1 0 1 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 23 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 17 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 31 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 38 (7.36%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 36 (6.98%)
Methionine (Met, M)
n = 32 (6.2%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 17 24 8 3 35 2 12 5 1 4 15 16 4 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 6 15 17 0 12 12 19 5 12 8 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 22 1 4 8 15 1 1 2 10 8 0 0 10 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 4 11 9 0 2 1 5 0 1 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 108 140 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 159 214 120
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 15 2 5 18 1 8 6 0 1 6 7 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 4 4 0 0 5 3 0 2 4 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 2 4 2 10 0 2 3 6 3 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 3 8 5 0 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 58 65 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 70 112 38
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 13 (4.98%)
Serine (Ser, S)
n = 22 (8.43%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 6 (2.3%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 8 4 7 15 0 7 7 0 1 7 9 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 7 3 0 2 10 7 1 4 4 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 3 4 10 0 0 5 2 9 0 0 3 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 1 2 3 0 1 1 3 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 67 61 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 56 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 103 106 50
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 20 (5.28%)
Threonine (Thr, T)
n = 30 (7.92%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 21 13 3 13 33 2 8 6 0 7 7 7 0 8 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 1 8 18 0 5 12 7 0 0 10 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 0 3 6 8 0 0 3 4 12 1 0 3 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 1 3 9 9 1 0 1 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 101 106 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 97 77 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 160 161 52
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 21 (6.6%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 14 (4.4%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 19 5 11 36 1 5 7 0 0 1 10 0 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 13 0 1 7 4 0 3 10 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 1 3 7 8 1 0 3 4 8 0 0 3 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 1 2 7 0 0 1 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 93 94 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 94 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 105 160 50
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 32 4 13 36 1 10 11 0 0 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 10 7 0 2 5 6 1 2 9 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 2 1 10 10 0 1 1 3 8 0 0 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 94 142 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 111 57 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 116 180 47
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 32 4 13 36 1 10 11 0 0 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 10 7 0 2 5 6 1 2 9 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 2 1 10 10 0 1 1 3 8 0 0 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 94 142 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 111 57 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 116 180 47
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 28 13 23 48 4 9 10 0 0 7 7 0 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 4 12 13 0 0 8 9 0 4 12 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 5 12 10 0 0 10 7 8 2 0 9 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 1 0 3 10 1 1 3 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 146 156 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 118 85 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 167 196 82
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 6 8 2 7 11 0 2 2 0 1 3 1 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 4 2 4 0 1 2 0 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 4 2 0 1 1 1 2 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 27 28 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 23 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 41 36 17
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 43 (7.1%)
Threonine (Thr, T)
n = 62 (10.23%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 15 (2.48%)
Leucine (Leu, L)
n = 102 (16.83%)
Isoleucine (Ile, I)
n = 52 (8.58%)
Methionine (Met, M)
n = 32 (5.28%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 33 30 15 26 43 4 14 19 1 2 5 8 0 17 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 4 23 14 0 2 7 16 2 8 13 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 25 1 5 18 9 1 6 4 8 8 1 0 12 23 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 3 9 21 0 2 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 162 212 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 167 130 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 240 235 119
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 28 (16.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 5 (2.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 2 0 0 1 0 7 0 1 13 1 6 8 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 6 0 2 1 10 1 4 12 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 3 0 1 2 7 0 8 1 3 10 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 3 0 1 3 0 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 6 43 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 26 28 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 4 32 89
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 253 (6.66%)
Serine (Ser, S)
n = 265 (6.97%)
Threonine (Thr, T)
n = 342 (9.0%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 183 (4.82%)
Leucine (Leu, L)
n = 630 (16.58%)
Isoleucine (Ile, I)
n = 309 (8.13%)
Methionine (Met, M)
n = 226 (5.95%)
Proline (Pro, P)
n = 204 (5.37%)
Phenylalanine (Phe, F)
n = 240 (6.32%)
Tyrosine (Tyr, Y)
n = 127 (3.34%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 156 (4.11%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
140 169 197 71 120 308 19 100 89 3 30 54 84 15 94 146
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 10 13 41 111 100 1 37 73 81 22 47 80 77 0 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
114 159 15 34 78 91 5 20 37 57 70 8 12 56 100 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 82 13 20 48 88 7 8 14 42 2 2 0 7 2 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
812 978 1187 824
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
466 1007 740 1588
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
153 1295 1604 749

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.