Viewing data for Chelus fimbriata


Scientific name Chelus fimbriata
Common name Mata mata
Maximum lifespan 35.80 years (Chelus fimbriata@AnAge)

Total mtDNA (size: 16661 bases) GC AT G C A T
Base content (bases) 6443 10218 4397 2046 4225 5993
Base content per 1 kb (bases) 387 613 264 123 254 360
Base content (%) 38.7% 61.3%
Total protein-coding genes (size: 11278 bases) GC AT G C A T
Base content (bases) 4444 6834 3193 1251 2871 3963
Base content per 1 kb (bases) 394 606 283 111 255 351
Base content (%) 39.4% 60.6%
D-loop (size: 1218 bases) GC AT G C A T
Base content (bases) 376 842 245 131 384 458
Base content per 1 kb (bases) 309 691 201 108 315 376
Base content (%) 30.9% 69.1%
Total tRNA-coding genes (size: 1548 bases) GC AT G C A T
Base content (bases) 598 950 364 234 395 555
Base content per 1 kb (bases) 386 614 235 151 255 359
Base content (%) 38.6% 61.4%
Total rRNA-coding genes (size: 2566 bases) GC AT G C A T
Base content (bases) 1003 1563 571 432 569 994
Base content per 1 kb (bases) 391 609 223 168 222 387
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 402 570 240 162 214 356
Base content per 1 kb (bases) 414 586 247 167 220 366
Base content (%) 41.4% 58.6%
16S rRNA gene (size: 1594 bases) GC AT G C A T
Base content (bases) 601 993 331 270 355 638
Base content per 1 kb (bases) 377 623 208 169 223 400
Base content (%) 37.7% 62.3%

ATP6 (size: 645 bases) GC AT G C A T
Base content (bases) 245 400 189 56 168 232
Base content per 1 kb (bases) 380 620 293 87 260 360
Base content (%) 38.0% 62.0%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 50 112 38 12 36 76
Base content per 1 kb (bases) 309 691 235 74 222 469
Base content (%) 30.9% 69.1%
COX1 (size: 1539 bases) GC AT G C A T
Base content (bases) 644 895 408 236 414 481
Base content per 1 kb (bases) 418 582 265 153 269 313
Base content (%) 41.8% 58.2%
COX2 (size: 682 bases) GC AT G C A T
Base content (bases) 271 411 185 86 163 248
Base content per 1 kb (bases) 397 603 271 126 239 364
Base content (%) 39.7% 60.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 315 469 205 110 211 258
Base content per 1 kb (bases) 402 598 261 140 269 329
Base content (%) 40.2% 59.8%
CYTB (size: 1128 bases) GC AT G C A T
Base content (bases) 454 674 326 128 293 381
Base content per 1 kb (bases) 402 598 289 113 260 338
Base content (%) 40.2% 59.8%
ND1 (size: 962 bases) GC AT G C A T
Base content (bases) 376 586 269 107 265 321
Base content per 1 kb (bases) 391 609 280 111 275 334
Base content (%) 39.1% 60.9%
ND2 (size: 1050 bases) GC AT G C A T
Base content (bases) 399 651 301 98 264 387
Base content per 1 kb (bases) 380 620 287 93 251 369
Base content (%) 38.0% 62.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 126 223 87 39 108 115
Base content per 1 kb (bases) 361 639 249 112 309 330
Base content (%) 36.1% 63.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 543 838 411 132 357 481
Base content per 1 kb (bases) 393 607 298 96 259 348
Base content (%) 39.3% 60.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 92 34 83 88
Base content per 1 kb (bases) 424 576 310 114 279 296
Base content (%) 42.4% 57.6%
ND5 (size: 1785 bases) GC AT G C A T
Base content (bases) 693 1092 520 173 440 652
Base content per 1 kb (bases) 388 612 291 97 246 365
Base content (%) 38.8% 61.2%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 204 321 163 41 72 249
Base content per 1 kb (bases) 389 611 310 78 137 474
Base content (%) 38.9% 61.1%

ATP6 (size: 645 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.74%)
Alanine (Ala, A)
n = 11 (5.14%)
Serine (Ser, S)
n = 15 (7.01%)
Threonine (Thr, T)
n = 25 (11.68%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.27%)
Leucine (Leu, L)
n = 51 (23.83%)
Isoleucine (Ile, I)
n = 21 (9.81%)
Methionine (Met, M)
n = 17 (7.94%)
Proline (Pro, P)
n = 16 (7.48%)
Phenylalanine (Phe, F)
n = 4 (1.87%)
Tyrosine (Tyr, Y)
n = 2 (0.93%)
Tryptophan (Trp, W)
n = 4 (1.87%)
Aspartic acid (Asp, D)
n = 1 (0.47%)
Glutamic acid (Glu, E)
n = 3 (1.4%)
Asparagine (Asn, N)
n = 10 (4.67%)
Glutamine (Gln, Q)
n = 7 (3.27%)
Histidine (His, H)
n = 3 (1.4%)
Lysine (Lys, K)
n = 4 (1.87%)
Arginine (Arg, R)
n = 5 (2.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 11 16 5 6 28 0 11 7 0 1 2 3 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 6 5 0 0 0 7 1 2 5 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 3 2 5 0 2 3 0 2 0 1 4 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 1 0 4 0 2 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
30 70 82 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 62 31 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 57 119 35
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPDPWLSILGTSWLMYLILQPKIKSHITTNLMTNNHKKKQKKTWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.89%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.66%)
Threonine (Thr, T)
n = 7 (13.21%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (13.21%)
Isoleucine (Ile, I)
n = 4 (7.55%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 5 (9.43%)
Phenylalanine (Phe, F)
n = 0 (0%)
Tyrosine (Tyr, Y)
n = 1 (1.89%)
Tryptophan (Trp, W)
n = 5 (9.43%)
Aspartic acid (Asp, D)
n = 1 (1.89%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.55%)
Glutamine (Gln, Q)
n = 3 (5.66%)
Histidine (His, H)
n = 2 (3.77%)
Lysine (Lys, K)
n = 7 (13.21%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 0 1 2 0 4 3 0 0 0 0 0 0 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 1 0 0 1 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 0 3 0 0 0 0 1 0 0 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 6 1 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 13 25 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 15 19 14
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 10 32 8
COX1 (size: 1539 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.98%)
Alanine (Ala, A)
n = 43 (8.4%)
Serine (Ser, S)
n = 34 (6.64%)
Threonine (Thr, T)
n = 33 (6.45%)
Cysteine (Cys, C)
n = 1 (0.2%)
Valine (Val, V)
n = 32 (6.25%)
Leucine (Leu, L)
n = 61 (11.91%)
Isoleucine (Ile, I)
n = 42 (8.2%)
Methionine (Met, M)
n = 33 (6.45%)
Proline (Pro, P)
n = 30 (5.86%)
Phenylalanine (Phe, F)
n = 37 (7.23%)
Tyrosine (Tyr, Y)
n = 18 (3.52%)
Tryptophan (Trp, W)
n = 17 (3.32%)
Aspartic acid (Asp, D)
n = 15 (2.93%)
Glutamic acid (Glu, E)
n = 9 (1.76%)
Asparagine (Asn, N)
n = 19 (3.71%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 17 (3.32%)
Lysine (Lys, K)
n = 9 (1.76%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 25 28 5 8 34 1 13 8 0 6 6 19 1 15 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 9 16 17 1 2 6 34 4 4 6 20 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 0 3 9 17 1 1 3 5 13 0 0 8 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 4 11 9 0 0 2 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
145 111 140 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 161 245 92
COX2 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 11 (4.87%)
Serine (Ser, S)
n = 17 (7.52%)
Threonine (Thr, T)
n = 19 (8.41%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 28 (12.39%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 18 (7.96%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 7 (3.1%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 11 (4.87%)
Glutamic acid (Glu, E)
n = 14 (6.19%)
Asparagine (Asn, N)
n = 6 (2.65%)
Glutamine (Gln, Q)
n = 12 (5.31%)
Histidine (His, H)
n = 10 (4.42%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 17 3 5 15 1 3 12 0 2 3 6 1 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 3 4 2 0 0 6 1 1 2 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 4 1 8 0 0 4 6 1 1 1 3 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 14 0 5 6 4 0 0 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 64 69 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 56 64 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 115 39
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 14 (5.38%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 7 12 6 1 16 0 8 9 0 1 1 11 0 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 8 3 1 2 2 14 2 1 3 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 19 1 3 3 6 0 1 3 4 7 1 1 1 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 0 2 1 2 1 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 64 71 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 57 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 73 130 49
CYTB (size: 1128 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.4%)
Alanine (Ala, A)
n = 20 (5.33%)
Serine (Ser, S)
n = 24 (6.4%)
Threonine (Thr, T)
n = 35 (9.33%)
Cysteine (Cys, C)
n = 5 (1.33%)
Valine (Val, V)
n = 12 (3.2%)
Leucine (Leu, L)
n = 61 (16.27%)
Isoleucine (Ile, I)
n = 32 (8.53%)
Methionine (Met, M)
n = 23 (6.13%)
Proline (Pro, P)
n = 21 (5.6%)
Phenylalanine (Phe, F)
n = 23 (6.13%)
Tyrosine (Tyr, Y)
n = 14 (3.73%)
Tryptophan (Trp, W)
n = 10 (2.67%)
Aspartic acid (Asp, D)
n = 7 (1.87%)
Glutamic acid (Glu, E)
n = 4 (1.07%)
Asparagine (Asn, N)
n = 23 (6.13%)
Glutamine (Gln, Q)
n = 9 (2.4%)
Histidine (His, H)
n = 11 (2.93%)
Lysine (Lys, K)
n = 10 (2.67%)
Arginine (Arg, R)
n = 7 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 21 20 6 4 37 2 12 9 0 0 3 7 2 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 4 9 7 0 2 7 12 3 2 5 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 16 1 2 6 15 0 0 1 4 10 1 0 6 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 1 6 9 1 0 0 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 97 124 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 99 79 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 130 178 54
ND1 (size: 962 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.7%)
Alanine (Ala, A)
n = 19 (5.96%)
Serine (Ser, S)
n = 32 (10.03%)
Threonine (Thr, T)
n = 23 (7.21%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.13%)
Leucine (Leu, L)
n = 57 (17.87%)
Isoleucine (Ile, I)
n = 25 (7.84%)
Methionine (Met, M)
n = 24 (7.52%)
Proline (Pro, P)
n = 21 (6.58%)
Phenylalanine (Phe, F)
n = 19 (5.96%)
Tyrosine (Tyr, Y)
n = 16 (5.02%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.45%)
Asparagine (Asn, N)
n = 13 (4.08%)
Glutamine (Gln, Q)
n = 7 (2.19%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 20 1 6 35 3 11 6 1 0 2 7 1 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 7 8 1 0 4 9 2 0 5 16 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 4 11 15 0 2 0 8 8 1 1 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 1 3 7 0 2 0 5 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 81 94 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 59 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 95 167 43
ND2 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.3%)
Alanine (Ala, A)
n = 17 (4.87%)
Serine (Ser, S)
n = 27 (7.74%)
Threonine (Thr, T)
n = 46 (13.18%)
Cysteine (Cys, C)
n = 6 (1.72%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 63 (18.05%)
Isoleucine (Ile, I)
n = 21 (6.02%)
Methionine (Met, M)
n = 29 (8.31%)
Proline (Pro, P)
n = 20 (5.73%)
Phenylalanine (Phe, F)
n = 11 (3.15%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 9 (2.58%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 19 (5.44%)
Glutamine (Gln, Q)
n = 14 (4.01%)
Histidine (His, H)
n = 14 (4.01%)
Lysine (Lys, K)
n = 16 (4.58%)
Arginine (Arg, R)
n = 2 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 27 9 6 33 1 14 13 1 1 1 3 1 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 4 5 8 4 0 3 3 8 1 3 6 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 3 4 7 8 0 0 8 4 3 2 0 10 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 0 0 2 15 1 0 0 2 0 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 99 140 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 102 77 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 100 170 68
ND3 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.3%)
Alanine (Ala, A)
n = 17 (4.87%)
Serine (Ser, S)
n = 27 (7.74%)
Threonine (Thr, T)
n = 46 (13.18%)
Cysteine (Cys, C)
n = 6 (1.72%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 63 (18.05%)
Isoleucine (Ile, I)
n = 21 (6.02%)
Methionine (Met, M)
n = 29 (8.31%)
Proline (Pro, P)
n = 20 (5.73%)
Phenylalanine (Phe, F)
n = 11 (3.15%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 9 (2.58%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 19 (5.44%)
Glutamine (Gln, Q)
n = 14 (4.01%)
Histidine (His, H)
n = 14 (4.01%)
Lysine (Lys, K)
n = 16 (4.58%)
Arginine (Arg, R)
n = 2 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 27 9 6 33 1 14 13 1 1 1 3 1 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 4 5 8 4 0 3 3 8 1 3 6 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 3 4 7 8 0 0 8 4 3 2 0 10 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 0 0 2 15 1 0 0 2 0 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 99 140 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 102 77 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 100 170 68
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.14%)
Alanine (Ala, A)
n = 25 (5.45%)
Serine (Ser, S)
n = 43 (9.37%)
Threonine (Thr, T)
n = 56 (12.2%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 78 (16.99%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 35 (7.63%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 19 (4.14%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 12 (2.61%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.74%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 17 (3.7%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 33 6 6 49 0 16 15 2 2 2 7 0 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 6 14 5 0 1 6 10 2 2 6 16 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 21 0 5 9 20 0 3 6 5 9 2 1 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 1 3 11 0 0 0 10 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 121 171 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 139 80 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 151 230 69
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 6 3 1 14 1 4 4 0 1 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 4 2 1 0 0 2 3 0 1 2 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 1 2 5 0 1 2 0 1 1 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 1 0 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 33 27 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 14 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 29 47 20
ND5 (size: 1785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (3.7%)
Alanine (Ala, A)
n = 39 (6.57%)
Serine (Ser, S)
n = 49 (8.25%)
Threonine (Thr, T)
n = 71 (11.95%)
Cysteine (Cys, C)
n = 7 (1.18%)
Valine (Val, V)
n = 16 (2.69%)
Leucine (Leu, L)
n = 91 (15.32%)
Isoleucine (Ile, I)
n = 53 (8.92%)
Methionine (Met, M)
n = 49 (8.25%)
Proline (Pro, P)
n = 30 (5.05%)
Phenylalanine (Phe, F)
n = 23 (3.87%)
Tyrosine (Tyr, Y)
n = 22 (3.7%)
Tryptophan (Trp, W)
n = 10 (1.68%)
Aspartic acid (Asp, D)
n = 14 (2.36%)
Glutamic acid (Glu, E)
n = 12 (2.02%)
Asparagine (Asn, N)
n = 15 (2.53%)
Glutamine (Gln, Q)
n = 18 (3.03%)
Histidine (His, H)
n = 16 (2.69%)
Lysine (Lys, K)
n = 28 (4.71%)
Arginine (Arg, R)
n = 9 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 36 42 11 7 49 3 20 18 0 3 2 10 1 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 5 5 20 14 0 1 4 16 1 2 8 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 35 1 7 14 21 0 2 5 5 17 0 1 3 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 12 0 3 11 27 1 0 1 8 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 143 223 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 182 126 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 195 303 82
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.22%)
Alanine (Ala, A)
n = 9 (5.17%)
Serine (Ser, S)
n = 14 (8.05%)
Threonine (Thr, T)
n = 3 (1.72%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 30 (17.24%)
Leucine (Leu, L)
n = 27 (15.52%)
Isoleucine (Ile, I)
n = 6 (3.45%)
Methionine (Met, M)
n = 8 (4.6%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 18 (10.34%)
Tyrosine (Tyr, Y)
n = 9 (5.17%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 5 (2.87%)
Glutamic acid (Glu, E)
n = 2 (1.15%)
Asparagine (Asn, N)
n = 4 (2.3%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.15%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 3 0 1 2 9 0 0 13 1 5 11 18 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 0 7 0 1 1 10 0 2 11 4 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 0 1 5 2 1 8 1 3 12 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 5 0 0 2 1 0 0 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 11 26 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 27 23 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 3 23 91
Total protein-coding genes (size: 11289 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.56%)
Alanine (Ala, A)
n = 222 (5.9%)
Serine (Ser, S)
n = 295 (7.85%)
Threonine (Thr, T)
n = 365 (9.71%)
Cysteine (Cys, C)
n = 36 (0.96%)
Valine (Val, V)
n = 156 (4.15%)
Leucine (Leu, L)
n = 602 (16.01%)
Isoleucine (Ile, I)
n = 294 (7.82%)
Methionine (Met, M)
n = 266 (7.07%)
Proline (Pro, P)
n = 208 (5.53%)
Phenylalanine (Phe, F)
n = 195 (5.19%)
Tyrosine (Tyr, Y)
n = 124 (3.3%)
Tryptophan (Trp, W)
n = 104 (2.77%)
Aspartic acid (Asp, D)
n = 71 (1.89%)
Glutamic acid (Glu, E)
n = 84 (2.23%)
Asparagine (Asn, N)
n = 145 (3.86%)
Glutamine (Gln, Q)
n = 111 (2.95%)
Histidine (His, H)
n = 102 (2.71%)
Lysine (Lys, K)
n = 102 (2.71%)
Arginine (Arg, R)
n = 62 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
134 160 230 61 52 329 14 128 107 4 30 23 83 20 79 116
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 11 25 50 95 71 6 22 34 124 29 22 50 134 2 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
141 166 8 43 67 129 6 14 36 49 75 12 18 52 93 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 78 6 24 47 95 7 7 5 50 0 1 0 5 2 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
742 939 1223 857
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 1040 746 1513
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
170 1093 1822 676

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.