Viewing data for Crocodylus siamensis


Scientific name Crocodylus siamensis
Common name Siamese crocodile
Maximum lifespan 21.90 years (Crocodylus siamensis@AnAge)

Total mtDNA (size: 16836 bases) GC AT G C A T
Base content (bases) 7279 9557 4793 2486 4168 5389
Base content per 1 kb (bases) 432 568 285 148 248 320
Base content (%) 43.2% 56.8%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 5016 6366 3465 1551 2876 3490
Base content per 1 kb (bases) 441 559 304 136 253 307
Base content (%) 44.1% 55.9%
D-loop (size: 1108 bases) GC AT G C A T
Base content (bases) 346 762 213 133 332 430
Base content per 1 kb (bases) 312 688 192 120 300 388
Base content (%) 31.2% 68.8%
Total tRNA-coding genes (size: 1543 bases) GC AT G C A T
Base content (bases) 664 879 387 277 396 483
Base content per 1 kb (bases) 430 570 251 180 257 313
Base content (%) 43.0% 57.0%
Total rRNA-coding genes (size: 2582 bases) GC AT G C A T
Base content (bases) 1156 1426 657 499 526 900
Base content per 1 kb (bases) 448 552 254 193 204 349
Base content (%) 44.8% 55.2%
12S rRNA gene (size: 985 bases) GC AT G C A T
Base content (bases) 471 514 268 203 190 324
Base content per 1 kb (bases) 478 522 272 206 193 329
Base content (%) 47.8% 52.2%
16S rRNA gene (size: 1597 bases) GC AT G C A T
Base content (bases) 685 912 389 296 336 576
Base content per 1 kb (bases) 429 571 244 185 210 361
Base content (%) 42.9% 57.1%

ATP6 (size: 696 bases) GC AT G C A T
Base content (bases) 299 397 219 80 172 225
Base content per 1 kb (bases) 430 570 315 115 247 323
Base content (%) 43.0% 57.0%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 63 99 48 15 38 61
Base content per 1 kb (bases) 389 611 296 93 235 377
Base content (%) 38.9% 61.1%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 687 870 432 255 417 453
Base content per 1 kb (bases) 441 559 277 164 268 291
Base content (%) 44.1% 55.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 281 403 187 94 172 231
Base content per 1 kb (bases) 411 589 273 137 251 338
Base content (%) 41.1% 58.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 360 424 232 128 205 219
Base content per 1 kb (bases) 459 541 296 163 261 279
Base content (%) 45.9% 54.1%
CYTB (size: 1156 bases) GC AT G C A T
Base content (bases) 522 634 360 162 301 333
Base content per 1 kb (bases) 452 548 311 140 260 288
Base content (%) 45.2% 54.8%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 432 531 285 147 261 270
Base content per 1 kb (bases) 449 551 296 153 271 280
Base content (%) 44.9% 55.1%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 464 592 341 123 269 323
Base content per 1 kb (bases) 439 561 323 116 255 306
Base content (%) 43.9% 56.1%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 154 194 95 59 93 101
Base content per 1 kb (bases) 443 557 273 170 267 290
Base content (%) 44.3% 55.7%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 589 785 418 171 350 435
Base content per 1 kb (bases) 429 571 304 124 255 317
Base content (%) 42.9% 57.1%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 132 162 97 35 86 76
Base content per 1 kb (bases) 449 551 330 119 293 259
Base content (%) 44.9% 55.1%
ND5 (size: 1854 bases) GC AT G C A T
Base content (bases) 840 1014 592 248 442 572
Base content per 1 kb (bases) 453 547 319 134 238 309
Base content (%) 45.3% 54.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 228 300 183 45 83 217
Base content per 1 kb (bases) 432 568 347 85 157 411
Base content (%) 43.2% 56.8%

ATP6 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.03%)
Alanine (Ala, A)
n = 17 (7.36%)
Serine (Ser, S)
n = 13 (5.63%)
Threonine (Thr, T)
n = 28 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.46%)
Leucine (Leu, L)
n = 62 (26.84%)
Isoleucine (Ile, I)
n = 19 (8.23%)
Methionine (Met, M)
n = 12 (5.19%)
Proline (Pro, P)
n = 15 (6.49%)
Phenylalanine (Phe, F)
n = 4 (1.73%)
Tyrosine (Tyr, Y)
n = 4 (1.73%)
Tryptophan (Trp, W)
n = 4 (1.73%)
Aspartic acid (Asp, D)
n = 2 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.73%)
Asparagine (Asn, N)
n = 12 (5.19%)
Glutamine (Gln, Q)
n = 7 (3.03%)
Histidine (His, H)
n = 4 (1.73%)
Lysine (Lys, K)
n = 5 (2.16%)
Arginine (Arg, R)
n = 4 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 7 8 9 29 7 9 4 3 0 1 5 2 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 0 8 7 2 0 3 3 1 1 2 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 1 2 3 6 0 0 2 1 3 1 0 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 1 3 2 0 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 83 78 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 71 39 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 65 108 34
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMILSITWLVLITTLQPKIASLKFMNSPSSPAQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.77%)
Serine (Ser, S)
n = 5 (9.43%)
Threonine (Thr, T)
n = 6 (11.32%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 7 (13.21%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 1 (1.89%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 2 (3.77%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 0 1 2 0 4 3 1 0 0 1 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 0 0 0 0 0 0 1 3 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 1 0 0 0 3 0 0 1 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 15 23 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 18 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 26 9
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.72%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 40 (7.72%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 30 (5.79%)
Phenylalanine (Phe, F)
n = 46 (8.88%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 11 (2.12%)
Histidine (His, H)
n = 17 (3.28%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 20 26 5 13 23 6 6 9 2 6 11 19 4 20 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 17 13 0 2 11 26 4 3 7 17 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 3 2 9 16 1 2 5 5 12 3 1 5 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 3 5 9 11 0 1 1 6 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 114 146 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 98 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 185 209 89
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 10 3 2 17 3 6 8 2 3 3 7 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 2 6 0 1 1 3 3 5 2 6 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 1 2 5 5 0 3 2 5 4 2 0 2 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 0 2 8 3 0 0 3 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 64 67 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 57 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 66 102 44
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 9 4 2 19 2 6 4 2 2 9 4 0 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 10 5 1 1 5 7 5 1 1 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 2 1 2 6 1 0 6 6 5 2 0 1 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 2 1 3 1 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 67 65 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 53 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 100 101 40
CYTB (size: 1156 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.25%)
Alanine (Ala, A)
n = 25 (6.51%)
Serine (Ser, S)
n = 27 (7.03%)
Threonine (Thr, T)
n = 27 (7.03%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 16 (4.17%)
Leucine (Leu, L)
n = 66 (17.19%)
Isoleucine (Ile, I)
n = 29 (7.55%)
Methionine (Met, M)
n = 19 (4.95%)
Proline (Pro, P)
n = 24 (6.25%)
Phenylalanine (Phe, F)
n = 28 (7.29%)
Tyrosine (Tyr, Y)
n = 15 (3.91%)
Tryptophan (Trp, W)
n = 12 (3.13%)
Aspartic acid (Asp, D)
n = 9 (2.34%)
Glutamic acid (Glu, E)
n = 6 (1.56%)
Asparagine (Asn, N)
n = 17 (4.43%)
Glutamine (Gln, Q)
n = 8 (2.08%)
Histidine (His, H)
n = 12 (3.13%)
Lysine (Lys, K)
n = 9 (2.34%)
Arginine (Arg, R)
n = 11 (2.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 20 13 5 12 23 6 18 6 2 1 8 6 1 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 2 13 10 0 1 4 12 7 2 5 15 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 0 4 10 8 2 0 3 2 13 1 2 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 0 9 9 0 2 1 6 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 101 104 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 100 76 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 159 153 42
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 30 (9.38%)
Serine (Ser, S)
n = 26 (8.13%)
Threonine (Thr, T)
n = 29 (9.06%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.69%)
Leucine (Leu, L)
n = 65 (20.31%)
Isoleucine (Ile, I)
n = 24 (7.5%)
Methionine (Met, M)
n = 12 (3.75%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 18 (5.63%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 10 7 3 31 10 11 6 0 4 6 4 1 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 14 12 0 1 8 2 5 2 7 7 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 1 4 6 9 2 0 5 3 8 1 3 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 5 3 0 6 1 1 1 4 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 85 89 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 98 51 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 102 130 54
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 33 (9.4%)
Serine (Ser, S)
n = 31 (8.83%)
Threonine (Thr, T)
n = 42 (11.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 35 (9.97%)
Methionine (Met, M)
n = 12 (3.42%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 12 (3.42%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 10 10 13 24 6 10 13 2 1 3 5 5 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 19 9 0 0 6 4 1 3 2 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 23 1 3 15 9 1 0 3 3 6 1 2 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 3 0 1 11 1 0 2 2 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 93 116 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 120 61 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 128 146 51
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 33 (9.4%)
Serine (Ser, S)
n = 31 (8.83%)
Threonine (Thr, T)
n = 42 (11.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 35 (9.97%)
Methionine (Met, M)
n = 12 (3.42%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 12 (3.42%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 10 10 13 24 6 10 13 2 1 3 5 5 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 19 9 0 0 6 4 1 3 2 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 23 1 3 15 9 1 0 3 3 6 1 2 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 3 0 1 11 1 0 2 2 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 93 116 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 120 61 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 128 146 51
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.81%)
Alanine (Ala, A)
n = 35 (7.66%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 52 (11.38%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 91 (19.91%)
Isoleucine (Ile, I)
n = 33 (7.22%)
Methionine (Met, M)
n = 34 (7.44%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 12 (2.63%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 12 (2.63%)
Glutamine (Gln, Q)
n = 17 (3.72%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 14 27 12 12 42 8 16 16 1 1 4 8 2 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 5 2 20 12 1 3 6 11 2 1 9 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 22 2 3 11 13 3 2 6 4 8 2 1 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 1 5 8 0 0 0 8 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 133 147 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 140 75 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 145 213 70
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 11 (11.34%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 22 (22.68%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 3 (3.09%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 8 (8.25%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 6 (6.19%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 2 1 5 8 4 4 1 0 0 0 2 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 1 6 1 0 1 2 0 1 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 3 1 5 1 0 1 0 0 1 0 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 26 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 31 14 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 40 33 17
ND5 (size: 1854 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.05%)
Alanine (Ala, A)
n = 60 (9.72%)
Serine (Ser, S)
n = 52 (8.43%)
Threonine (Thr, T)
n = 62 (10.05%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 24 (3.89%)
Leucine (Leu, L)
n = 99 (16.05%)
Isoleucine (Ile, I)
n = 59 (9.56%)
Methionine (Met, M)
n = 32 (5.19%)
Proline (Pro, P)
n = 30 (4.86%)
Phenylalanine (Phe, F)
n = 29 (4.7%)
Tyrosine (Tyr, Y)
n = 15 (2.43%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 12 (1.94%)
Glutamic acid (Glu, E)
n = 14 (2.27%)
Asparagine (Asn, N)
n = 25 (4.05%)
Glutamine (Gln, Q)
n = 21 (3.4%)
Histidine (His, H)
n = 15 (2.43%)
Lysine (Lys, K)
n = 24 (3.89%)
Arginine (Arg, R)
n = 8 (1.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 37 22 10 14 45 15 11 16 5 3 5 14 2 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 4 13 27 18 2 2 10 9 4 5 10 13 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 21 2 2 16 21 1 2 10 2 13 0 4 5 20 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 6 1 11 21 3 0 3 4 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 158 214 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 192 127 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 242 231 88
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.57%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 4 (2.29%)
Cysteine (Cys, C)
n = 6 (3.43%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 28 (16.0%)
Isoleucine (Ile, I)
n = 7 (4.0%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 6 (3.43%)
Glutamic acid (Glu, E)
n = 4 (2.29%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 1 4 5 1 2 2 9 0 0 9 1 3 12 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 6 0 6 1 3 2 10 0 6 13 0 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 2 0 1 1 7 0 6 1 3 9 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 1 1 1 2 0 0 2 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 17 29 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 21 22 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 7 32 82
Total protein-coding genes (size: 11456 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.58%)
Alanine (Ala, A)
n = 301 (7.89%)
Serine (Ser, S)
n = 287 (7.52%)
Threonine (Thr, T)
n = 352 (9.22%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 191 (5.0%)
Leucine (Leu, L)
n = 648 (16.98%)
Isoleucine (Ile, I)
n = 300 (7.86%)
Methionine (Met, M)
n = 199 (5.21%)
Proline (Pro, P)
n = 200 (5.24%)
Phenylalanine (Phe, F)
n = 218 (5.71%)
Tyrosine (Tyr, Y)
n = 112 (2.93%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 70 (1.83%)
Glutamic acid (Glu, E)
n = 92 (2.41%)
Asparagine (Asn, N)
n = 132 (3.46%)
Glutamine (Gln, Q)
n = 108 (2.83%)
Histidine (His, H)
n = 97 (2.54%)
Lysine (Lys, K)
n = 89 (2.33%)
Arginine (Arg, R)
n = 70 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
136 164 149 74 89 278 72 113 88 20 30 52 80 29 82 136
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 11 17 47 146 100 8 22 59 85 47 25 49 111 15 45
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
136 156 15 30 80 101 13 17 46 38 74 19 22 34 98 23
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 65 27 19 51 79 10 6 15 41 8 0 2 9 0 81
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
867 988 1137 826
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
476 1077 709 1556
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
357 1286 1536 639

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.