Viewing data for Anolis carolinensis


Scientific name Anolis carolinensis
Common name Green anole
Maximum lifespan 7.20 years (Anolis carolinensis@AnAge)

Total mtDNA (size: 17223 bases) GC AT G C A T
Base content (bases) 6613 10607 4210 2403 5027 5580
Base content per 1 kb (bases) 384 616 244 140 292 324
Base content (%) 38.4% 61.6%
Total protein-coding genes (size: 11322 bases) GC AT G C A T
Base content (bases) 4434 6888 2927 1507 3373 3515
Base content per 1 kb (bases) 392 608 259 133 298 310
Base content (%) 39.2% 60.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1520 bases) GC AT G C A T
Base content (bases) 560 959 324 236 425 534
Base content per 1 kb (bases) 368 631 213 155 280 351
Base content (%) 36.8% 63.1%
Total rRNA-coding genes (size: 2458 bases) GC AT G C A T
Base content (bases) 917 1541 514 403 586 955
Base content per 1 kb (bases) 373 627 209 164 238 389
Base content (%) 37.3% 62.7%
12S rRNA gene (size: 936 bases) GC AT G C A T
Base content (bases) 355 581 199 156 225 356
Base content per 1 kb (bases) 379 621 213 167 240 380
Base content (%) 37.9% 62.1%
16S rRNA gene (size: 1522 bases) GC AT G C A T
Base content (bases) 562 960 315 247 361 599
Base content per 1 kb (bases) 369 631 207 162 237 394
Base content (%) 36.9% 63.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 246 438 170 76 227 211
Base content per 1 kb (bases) 360 640 249 111 332 308
Base content (%) 36.0% 64.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 65 103 51 14 44 59
Base content per 1 kb (bases) 387 613 304 83 262 351
Base content (%) 38.7% 61.3%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 647 898 358 289 499 399
Base content per 1 kb (bases) 419 581 232 187 323 258
Base content (%) 41.9% 58.1%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 272 416 181 91 182 234
Base content per 1 kb (bases) 395 605 263 132 265 340
Base content (%) 39.5% 60.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 337 447 197 140 230 217
Base content per 1 kb (bases) 430 570 251 179 293 277
Base content (%) 43.0% 57.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 433 707 281 152 374 333
Base content per 1 kb (bases) 380 620 246 133 328 292
Base content (%) 38.0% 62.0%
ND1 (size: 961 bases) GC AT G C A T
Base content (bases) 375 586 252 123 297 289
Base content per 1 kb (bases) 390 610 262 128 309 301
Base content (%) 39.0% 61.0%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 380 656 278 102 311 345
Base content per 1 kb (bases) 367 633 268 98 300 333
Base content (%) 36.7% 63.3%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 139 207 84 55 113 94
Base content per 1 kb (bases) 402 598 243 159 327 272
Base content (%) 40.2% 59.8%
ND4 (size: 1365 bases) GC AT G C A T
Base content (bases) 549 816 388 161 401 415
Base content per 1 kb (bases) 402 598 284 118 294 304
Base content (%) 40.2% 59.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 121 176 84 37 91 85
Base content per 1 kb (bases) 407 593 283 125 306 286
Base content (%) 40.7% 59.3%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 652 1154 443 209 546 608
Base content per 1 kb (bases) 361 639 245 116 302 337
Base content (%) 36.1% 63.9%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 223 302 163 60 65 237
Base content per 1 kb (bases) 425 575 310 114 124 451
Base content (%) 42.5% 57.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 3 (1.32%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 2 11 20 1 21 4 5 7 0 4 3 5 1 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 5 7 0 0 5 4 0 3 2 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 2 1 6 0 1 3 0 3 1 2 8 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 3 0 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 75 76 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 60 32 115
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 35 103 77
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWLMIFFLIWLFLTLVLFNKALKPMFPNTTETKEMTKPAPQPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 4 0 3 0 1 1 1 1 0 0 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 2 0 0 0 0 0 0 1 4 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 0 1 0 0 0 0 0 1 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 19 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 14 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 16 26 10
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 46 (8.95%)
Serine (Ser, S)
n = 34 (6.61%)
Threonine (Thr, T)
n = 32 (6.23%)
Cysteine (Cys, C)
n = 3 (0.58%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 62 (12.06%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 29 (5.64%)
Proline (Pro, P)
n = 27 (5.25%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 15 (2.92%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 8 (1.56%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 8 20 20 3 17 3 17 5 4 16 4 10 8 36 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 2 7 21 16 2 5 14 18 10 6 3 14 4 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 7 8 13 0 1 5 12 6 3 2 6 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 3 6 9 7 1 3 1 3 1 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 105 127 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
82 133 93 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 120 179 165
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 14 (6.14%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 23 (10.09%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.39%)
Leucine (Leu, L)
n = 28 (12.28%)
Isoleucine (Ile, I)
n = 22 (9.65%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 14 6 2 11 3 6 7 1 3 1 4 2 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 8 3 0 1 0 5 2 1 3 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 1 4 7 0 1 2 5 3 0 0 1 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 2 6 6 3 0 0 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 58 74 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 61 99 57
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 7 7 1 9 5 6 7 0 4 7 8 1 19 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 5 14 0 1 8 5 5 4 1 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 0 0 1 7 1 2 3 5 6 0 1 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 0 5 1 2 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 61 56 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 55 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 71 106 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 13 16 16 7 12 3 13 7 1 7 5 6 2 22 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 12 10 0 3 9 11 3 3 6 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 2 7 6 10 0 1 1 7 7 0 3 6 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 1 2 5 9 1 0 1 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 88 111 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 90 77 163
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 103 145 113
ND1 (size: 961 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.39%)
Alanine (Ala, A)
n = 26 (8.15%)
Serine (Ser, S)
n = 23 (7.21%)
Threonine (Thr, T)
n = 23 (7.21%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 16 (5.02%)
Leucine (Leu, L)
n = 62 (19.44%)
Isoleucine (Ile, I)
n = 24 (7.52%)
Methionine (Met, M)
n = 15 (4.7%)
Proline (Pro, P)
n = 22 (6.9%)
Phenylalanine (Phe, F)
n = 20 (6.27%)
Tyrosine (Tyr, Y)
n = 11 (3.45%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.45%)
Glutamine (Gln, Q)
n = 11 (3.45%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.51%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 3 13 14 7 24 6 11 10 1 4 5 7 0 16 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 10 13 0 4 4 5 1 1 3 16 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 7 2 11 0 0 3 8 3 3 0 4 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 2 3 1 7 1 0 0 8 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 94 84 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 91 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 67 148 87
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 21 (6.1%)
Serine (Ser, S)
n = 36 (10.47%)
Threonine (Thr, T)
n = 49 (14.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 59 (17.15%)
Isoleucine (Ile, I)
n = 39 (11.34%)
Methionine (Met, M)
n = 24 (6.98%)
Proline (Pro, P)
n = 17 (4.94%)
Phenylalanine (Phe, F)
n = 14 (4.07%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.49%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 9 (2.62%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 7 21 10 5 24 2 16 5 4 3 0 1 1 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 10 9 0 2 6 3 3 3 2 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 2 5 12 14 0 0 5 5 4 2 2 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 2 9 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 77 138 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 118 52 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 83 155 86
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 21 (6.1%)
Serine (Ser, S)
n = 36 (10.47%)
Threonine (Thr, T)
n = 49 (14.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 59 (17.15%)
Isoleucine (Ile, I)
n = 39 (11.34%)
Methionine (Met, M)
n = 24 (6.98%)
Proline (Pro, P)
n = 17 (4.94%)
Phenylalanine (Phe, F)
n = 14 (4.07%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.49%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 9 (2.62%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 7 21 10 5 24 2 16 5 4 3 0 1 1 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 10 9 0 2 6 3 3 3 2 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 2 5 12 14 0 0 5 5 4 2 2 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 2 9 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 77 138 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 118 52 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 83 155 86
ND4 (size: 1365 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.3%)
Alanine (Ala, A)
n = 31 (6.83%)
Serine (Ser, S)
n = 33 (7.27%)
Threonine (Thr, T)
n = 48 (10.57%)
Cysteine (Cys, C)
n = 5 (1.1%)
Valine (Val, V)
n = 13 (2.86%)
Leucine (Leu, L)
n = 93 (20.48%)
Isoleucine (Ile, I)
n = 42 (9.25%)
Methionine (Met, M)
n = 28 (6.17%)
Proline (Pro, P)
n = 25 (5.51%)
Phenylalanine (Phe, F)
n = 20 (4.41%)
Tyrosine (Tyr, Y)
n = 12 (2.64%)
Tryptophan (Trp, W)
n = 10 (2.2%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.76%)
Asparagine (Asn, N)
n = 22 (4.85%)
Glutamine (Gln, Q)
n = 13 (2.86%)
Histidine (His, H)
n = 12 (2.64%)
Lysine (Lys, K)
n = 9 (1.98%)
Arginine (Arg, R)
n = 12 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 12 22 17 7 27 8 30 9 4 6 1 5 1 12 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 6 11 12 2 1 5 7 2 1 11 12 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 19 2 7 10 6 1 0 9 3 9 3 4 6 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 4 0 3 8 1 1 2 8 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 121 158 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 128 80 196
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 139 177 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 14 (14.29%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 7 0 7 2 5 3 0 1 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 1 4 3 2 3 1 1 0 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 1 2 6 0 0 1 1 0 0 0 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 27 29 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 35 16 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 22 40 31
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 43 (7.15%)
Serine (Ser, S)
n = 55 (9.15%)
Threonine (Thr, T)
n = 57 (9.48%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.16%)
Leucine (Leu, L)
n = 97 (16.14%)
Isoleucine (Ile, I)
n = 56 (9.32%)
Methionine (Met, M)
n = 47 (7.82%)
Proline (Pro, P)
n = 26 (4.33%)
Phenylalanine (Phe, F)
n = 39 (6.49%)
Tyrosine (Tyr, Y)
n = 10 (1.66%)
Tryptophan (Trp, W)
n = 11 (1.83%)
Aspartic acid (Asp, D)
n = 11 (1.83%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 33 (5.49%)
Glutamine (Gln, Q)
n = 17 (2.83%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 24 (3.99%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
47 9 42 14 10 34 9 26 15 2 4 1 8 0 24 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 5 17 21 0 7 10 6 3 4 7 13 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 28 2 9 8 19 2 8 9 6 4 1 4 13 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 4 6 5 20 4 0 0 8 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 132 234 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 164 118 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 147 256 160
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.09%)
Alanine (Ala, A)
n = 13 (7.47%)
Serine (Ser, S)
n = 13 (7.47%)
Threonine (Thr, T)
n = 5 (2.87%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 25 (14.37%)
Leucine (Leu, L)
n = 24 (13.79%)
Isoleucine (Ile, I)
n = 8 (4.6%)
Methionine (Met, M)
n = 4 (2.3%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 20 (11.49%)
Tyrosine (Tyr, Y)
n = 8 (4.6%)
Tryptophan (Trp, W)
n = 2 (1.15%)
Aspartic acid (Asp, D)
n = 4 (2.3%)
Glutamic acid (Glu, E)
n = 5 (2.87%)
Asparagine (Asn, N)
n = 3 (1.72%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 2 2 0 2 0 8 0 0 14 1 3 7 20 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 1 8 1 1 3 7 8 1 12 1 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 10 0 0 2 1 0 7 1 2 12 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 5 3 1 0 0 3 0 0 1 0 1 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 12 22 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 34 20 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 14 23 90
Total protein-coding genes (size: 11345 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.74%)
Alanine (Ala, A)
n = 272 (7.2%)
Serine (Ser, S)
n = 282 (7.46%)
Threonine (Thr, T)
n = 329 (8.71%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 180 (4.76%)
Leucine (Leu, L)
n = 618 (16.35%)
Isoleucine (Ile, I)
n = 323 (8.55%)
Methionine (Met, M)
n = 215 (5.69%)
Proline (Pro, P)
n = 200 (5.29%)
Phenylalanine (Phe, F)
n = 247 (6.54%)
Tyrosine (Tyr, Y)
n = 108 (2.86%)
Tryptophan (Trp, W)
n = 100 (2.65%)
Aspartic acid (Asp, D)
n = 68 (1.8%)
Glutamic acid (Glu, E)
n = 91 (2.41%)
Asparagine (Asn, N)
n = 147 (3.89%)
Glutamine (Gln, Q)
n = 97 (2.57%)
Histidine (His, H)
n = 95 (2.51%)
Lysine (Lys, K)
n = 82 (2.17%)
Arginine (Arg, R)
n = 72 (1.91%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
253 70 174 143 44 202 47 150 79 18 68 29 58 25 190 57
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 9 20 43 109 110 10 35 73 68 41 29 43 116 12 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
105 167 10 56 57 102 10 15 42 60 48 16 32 59 88 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 63 28 27 41 71 11 8 5 54 5 1 1 6 0 84
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
828 900 1155 897
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 1026 694 1583
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
307 901 1505 1067

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.