Viewing data for Axis porcinus


Scientific name Axis porcinus
Common name Hog deer
Maximum lifespan 22.90 years (Axis porcinus@AnAge)

Total mtDNA (size: 16375 bases) GC AT G C A T
Base content (bases) 6131 10244 3969 2162 4765 5479
Base content per 1 kb (bases) 374 626 242 132 291 335
Base content (%) 37.4% 62.6%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4260 7078 2900 1360 3402 3676
Base content per 1 kb (bases) 376 624 256 120 300 324
Base content (%) 37.6% 62.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1516 bases) GC AT G C A T
Base content (bases) 535 981 308 227 430 551
Base content per 1 kb (bases) 353 647 203 150 284 363
Base content (%) 35.3% 64.7%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 965 1561 530 435 611 950
Base content per 1 kb (bases) 382 618 210 172 242 376
Base content (%) 38.2% 61.8%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 379 577 211 168 227 350
Base content per 1 kb (bases) 396 604 221 176 237 366
Base content (%) 39.6% 60.4%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 586 984 319 267 384 600
Base content per 1 kb (bases) 373 627 203 170 245 382
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 262 419 177 85 209 210
Base content per 1 kb (bases) 385 615 260 125 307 308
Base content (%) 38.5% 61.5%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 59 142 47 12 58 84
Base content per 1 kb (bases) 294 706 234 60 289 418
Base content (%) 29.4% 70.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 587 958 336 251 511 447
Base content per 1 kb (bases) 380 620 217 162 331 289
Base content (%) 38.0% 62.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 252 432 157 95 193 239
Base content per 1 kb (bases) 368 632 230 139 282 349
Base content (%) 36.8% 63.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 329 455 216 113 238 217
Base content per 1 kb (bases) 420 580 276 144 304 277
Base content (%) 42.0% 58.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 453 687 307 146 330 357
Base content per 1 kb (bases) 397 603 269 128 289 313
Base content (%) 39.7% 60.3%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 372 584 258 114 285 299
Base content per 1 kb (bases) 389 611 270 119 298 313
Base content (%) 38.9% 61.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 353 689 261 92 307 382
Base content per 1 kb (bases) 339 661 250 88 295 367
Base content (%) 33.9% 66.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 141 205 98 43 101 104
Base content per 1 kb (bases) 408 592 283 124 292 301
Base content (%) 40.8% 59.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 515 863 374 141 418 445
Base content per 1 kb (bases) 374 626 271 102 303 323
Base content (%) 37.4% 62.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 99 198 60 39 106 92
Base content per 1 kb (bases) 333 667 202 131 357 310
Base content (%) 33.3% 66.7%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 660 1161 470 190 551 610
Base content per 1 kb (bases) 362 638 258 104 303 335
Base content (%) 36.2% 63.8%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 197 331 152 45 117 214
Base content per 1 kb (bases) 373 627 288 85 222 405
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 20 (8.85%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 3 10 8 8 16 2 7 9 0 6 0 5 2 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 8 7 0 0 4 5 3 1 3 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 0 4 0 5 0 1 4 1 1 0 2 9 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 3 1 1 2 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 65 77 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 48 96 70
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMIMSMFLTLFIIFQLKISKHNFHFNPELTLTKTQKEDTPWKTKWTKIYLPLSLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 2 (3.03%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 4 (6.06%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 2 1 3 1 2 4 0 0 0 0 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 0 1 3 0 0 0 1 0 0 1 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 1 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 28 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 21 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 10 35 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 9 29 8 6 14 8 21 5 1 10 5 20 2 25 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 12 11 14 2 13 9 20 5 10 7 9 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 22 1 9 5 14 0 1 2 11 8 0 2 13 6 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 7 8 9 0 2 1 5 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 95 141 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 109 210 169
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 12 2 2 19 2 8 5 1 5 1 7 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 2 3 0 0 3 5 0 3 2 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 11 3 6 3 6 1 2 3 9 2 0 0 3 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 3 7 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 57 68 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 45 110 58
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 8 6 3 12 1 9 7 0 5 6 4 1 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 5 4 0 2 9 8 1 2 4 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 2 5 8 0 2 2 5 6 1 1 3 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 2 1 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 63 62 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 88 99 66
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 18 14 5 12 23 3 10 6 0 4 7 7 1 12 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 2 2 19 0 1 6 15 2 3 6 14 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 1 4 6 9 0 0 3 7 8 1 1 7 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 4 7 9 0 0 1 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 91 115 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 76 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 125 166 78
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 18 (5.68%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 11 17 5 8 30 2 10 7 0 3 4 8 1 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 10 15 1 0 6 5 1 5 9 6 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 1 4 7 9 0 2 1 7 4 0 0 7 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 7 0 1 1 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 85 91 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 55 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 85 152 70
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 12 36 5 10 28 0 10 9 1 5 3 4 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 7 8 1 2 3 8 1 1 9 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 5 4 17 2 0 1 6 2 1 1 7 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 82 146 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 78 177 77
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 12 36 5 10 28 0 10 9 1 5 3 4 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 7 8 1 2 3 8 1 1 9 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 5 4 17 2 0 1 6 2 1 1 7 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 82 146 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 78 177 77
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 14 30 13 17 40 3 20 10 1 2 4 9 1 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 5 11 11 0 1 8 9 0 5 6 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 0 8 10 11 1 3 9 10 7 0 0 7 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 1 0 3 11 0 1 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 125 156 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 112 84 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 137 205 105
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 10 3 2 7 0 10 2 0 3 0 3 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 4 6 0 0 1 3 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 3 2 2 0 0 1 4 0 0 1 4 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 18 27 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 19 48 26
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 15 (2.48%)
Leucine (Leu, L)
n = 84 (13.86%)
Isoleucine (Ile, I)
n = 65 (10.73%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 49 (8.09%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
43 22 36 11 12 42 4 15 17 2 1 6 7 1 25 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 6 15 19 1 7 8 12 1 6 10 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 29 1 8 14 13 1 3 9 11 8 0 0 24 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 2 2 10 22 0 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 133 231 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 156 132 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 181 247 160
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 4 2 0 2 0 12 1 1 7 1 6 9 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 3 0 0 4 12 1 3 10 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 4 1 0 2 4 0 8 2 2 2 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 1 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 10 47 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 9 37 83
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 245 (6.45%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 302 (7.95%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 585 (15.4%)
Isoleucine (Ile, I)
n = 341 (8.98%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 192 (5.06%)
Phenylalanine (Phe, F)
n = 251 (6.61%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 92 (2.42%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
238 103 214 74 87 246 28 139 85 7 52 37 82 19 131 120
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 2 20 45 82 109 9 38 59 96 24 40 63 83 6 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
67 164 10 58 59 100 7 19 36 81 50 5 11 90 76 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
52 80 17 26 43 90 5 7 15 40 1 1 0 7 0 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
818 874 1218 889
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 963 749 1625
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
193 969 1635 1002

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.