Viewing data for Fringilla coelebs


Scientific name Fringilla coelebs
Common name Chaffinch
Maximum lifespan 29.00 years (Fringilla coelebs@AnAge)

Total mtDNA (size: 16801 bases) GC AT G C A T
Base content (bases) 7745 9050 5359 2386 3929 5121
Base content per 1 kb (bases) 461 539 319 142 234 305
Base content (%) 46.1% 53.9%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5363 6012 3927 1436 2634 3378
Base content per 1 kb (bases) 471 528 345 126 231 297
Base content (%) 47.1% 52.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 636 901 371 265 387 514
Base content per 1 kb (bases) 413 585 241 172 251 334
Base content (%) 41.3% 58.5%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1190 1382 661 529 541 841
Base content per 1 kb (bases) 463 537 257 206 210 327
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 475 498 266 209 203 295
Base content per 1 kb (bases) 488 512 273 215 209 303
Base content (%) 48.8% 51.2%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 715 884 395 320 338 546
Base content per 1 kb (bases) 447 553 247 200 211 341
Base content (%) 44.7% 55.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 323 361 258 65 156 205
Base content per 1 kb (bases) 472 528 377 95 228 300
Base content (%) 47.2% 52.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 60 13 42 53
Base content per 1 kb (bases) 435 565 357 77 250 315
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 734 817 476 258 383 434
Base content per 1 kb (bases) 473 527 307 166 247 280
Base content (%) 47.3% 52.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 330 354 223 107 156 198
Base content per 1 kb (bases) 482 518 326 156 228 289
Base content (%) 48.2% 51.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 388 396 266 122 187 209
Base content per 1 kb (bases) 495 505 339 156 239 267
Base content (%) 49.5% 50.5%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 542 599 395 147 271 328
Base content per 1 kb (bases) 474 524 346 129 237 287
Base content (%) 47.4% 52.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 474 504 334 140 241 263
Base content per 1 kb (bases) 485 515 342 143 246 269
Base content (%) 48.5% 51.5%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 469 571 362 107 256 315
Base content per 1 kb (bases) 451 549 348 103 246 303
Base content (%) 45.1% 54.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 163 188 126 37 86 102
Base content per 1 kb (bases) 464 536 359 105 245 291
Base content (%) 46.4% 53.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 639 738 488 151 314 424
Base content per 1 kb (bases) 464 536 354 110 228 308
Base content (%) 46.4% 53.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 109 35 69 84
Base content per 1 kb (bases) 485 515 367 118 232 283
Base content (%) 48.5% 51.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 834 984 630 204 416 568
Base content per 1 kb (bases) 459 541 347 112 229 312
Base content (%) 45.9% 54.1%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 254 265 202 52 62 203
Base content per 1 kb (bases) 489 511 389 100 119 391
Base content (%) 48.9% 51.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 6 3 16 37 3 3 8 0 2 3 2 1 1 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 10 3 0 1 5 2 0 1 8 6 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 0 0 7 4 0 0 4 0 3 0 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 1 4 0 0 1 3 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 90 69 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 103 101 16
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFFIMLTSWLTFSLIIQPKLLTFVTMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 0 2 3 0 1 2 0 0 0 0 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 3 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 2 1 0 0 2 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 18 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 23 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 23 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 30 15 8 12 32 6 5 9 0 8 9 21 4 10 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 8 20 17 0 3 14 28 2 4 12 14 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 1 2 10 12 0 0 4 2 15 0 0 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 10 0 2 13 9 0 2 0 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 124 127 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 214 213 69
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 7 5 10 11 4 0 5 1 6 6 6 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 8 5 0 1 1 5 1 3 1 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 0 2 8 6 0 0 6 0 7 0 1 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 3 10 4 0 1 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 63 57 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 60 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 100 83 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 6 0 12 17 4 1 7 0 1 7 8 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 14 7 0 1 1 15 2 4 5 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 0 2 8 3 0 1 4 2 9 0 0 1 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 2 2 4 0 1 2 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 76 53 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 121 102 30
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 21 (5.53%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 35 (9.21%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 32 6 5 16 40 0 2 8 0 5 6 10 0 2 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 4 16 7 1 3 6 12 2 3 12 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 1 2 9 10 1 0 1 1 12 0 0 3 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 1 8 9 1 1 0 7 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 113 99 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 99 80 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 183 148 38
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 19 (5.85%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 8 6 12 31 9 6 5 1 1 6 9 0 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 14 11 4 3 3 6 1 4 13 6 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 2 11 5 1 1 5 6 9 0 0 0 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 0 4 7 0 0 3 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 99 82 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 141 122 37
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 21 13 11 18 25 4 8 8 2 2 6 1 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 13 13 0 0 5 6 1 3 6 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 0 5 12 7 1 0 5 0 7 0 0 0 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 2 12 2 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 103 121 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 115 59 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 144 134 52
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 21 13 11 18 25 4 8 8 2 2 6 1 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 13 13 0 0 5 6 1 3 6 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 0 5 12 7 1 0 5 0 7 0 0 0 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 2 12 2 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 103 121 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 115 59 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 144 134 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 31 (6.77%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 33 25 7 22 57 3 8 12 1 0 5 10 0 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 5 23 13 0 1 8 7 1 2 14 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 1 5 13 8 2 0 8 5 9 0 0 2 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 0 0 3 8 2 0 3 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 156 138 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 135 79 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 195 207 43
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 6 0 2 13 1 3 2 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 8 3 0 0 2 2 0 0 2 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 3 3 3 0 0 3 0 3 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 30 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 49 42 6
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 52 (8.6%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 99 (16.36%)
Isoleucine (Ile, I)
n = 57 (9.42%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 28 (4.63%)
Phenylalanine (Phe, F)
n = 39 (6.45%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 25 (4.13%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 50 28 6 20 65 3 5 15 3 3 7 6 1 3 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 6 4 28 14 0 1 12 17 3 7 10 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
35 20 1 4 19 19 0 0 10 2 10 0 0 2 23 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 0 1 8 19 1 1 2 4 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
117 162 210 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 182 110 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 286 248 56
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 13 (7.56%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 4 0 0 4 10 0 0 15 1 4 13 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 6 0 1 6 9 0 5 17 2 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 0 5 2 0 5 2 2 12 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 1 0 0 0 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 16 17 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 19 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 6 26 67
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 307 (8.09%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 308 (8.11%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 200 (5.27%)
Leucine (Leu, L)
n = 663 (17.47%)
Isoleucine (Ile, I)
n = 294 (7.74%)
Methionine (Met, M)
n = 167 (4.4%)
Proline (Pro, P)
n = 226 (5.95%)
Phenylalanine (Phe, F)
n = 219 (5.77%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
59 235 128 57 148 348 43 54 85 8 43 57 79 21 39 180
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 4 25 41 161 94 11 23 58 109 30 36 90 95 4 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
140 117 5 33 108 79 10 4 53 23 88 2 13 18 116 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 80 10 13 56 78 7 6 16 44 7 2 1 6 1 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
886 1091 1048 769
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1070 693 1543
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
212 1616 1502 464

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.