Viewing data for Capra falconeri


Scientific name Capra falconeri
Common name Markhor
Maximum lifespan 19.10 years (Capra falconeri@AnAge)

Total mtDNA (size: 16640 bases) GC AT G C A T
Base content (bases) 6524 10108 4328 2196 4550 5558
Base content per 1 kb (bases) 392 607 260 132 273 334
Base content (%) 39.2% 60.7%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4486 6841 3152 1334 3147 3694
Base content per 1 kb (bases) 396 604 278 118 278 326
Base content (%) 39.6% 60.4%
D-loop (size: 1027 bases) GC AT G C A T
Base content (bases) 410 617 253 157 294 323
Base content per 1 kb (bases) 399 601 246 153 286 315
Base content (%) 39.9% 60.1%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 535 976 311 224 435 541
Base content per 1 kb (bases) 354 646 206 148 288 358
Base content (%) 35.4% 64.6%
Total rRNA-coding genes (size: 2528 bases) GC AT G C A T
Base content (bases) 994 1534 546 448 601 933
Base content per 1 kb (bases) 393 607 216 177 238 369
Base content (%) 39.3% 60.7%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 394 562 221 173 213 349
Base content per 1 kb (bases) 412 588 231 181 223 365
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 600 972 325 275 388 584
Base content per 1 kb (bases) 382 618 207 175 247 372
Base content (%) 38.2% 61.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 272 404 200 72 186 218
Base content per 1 kb (bases) 399 593 294 106 273 320
Base content (%) 39.9% 59.3%
ATP8 (size: 198 bases) GC AT G C A T
Base content (bases) 65 133 50 15 56 77
Base content per 1 kb (bases) 328 672 253 76 283 389
Base content (%) 32.8% 67.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 648 896 395 253 451 445
Base content per 1 kb (bases) 419 580 256 164 292 288
Base content (%) 41.9% 58.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 256 428 162 94 190 238
Base content per 1 kb (bases) 374 626 237 137 278 348
Base content (%) 37.4% 62.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 336 448 219 117 242 206
Base content per 1 kb (bases) 429 571 279 149 309 263
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 471 668 323 148 305 363
Base content per 1 kb (bases) 413 586 283 130 268 318
Base content (%) 41.3% 58.6%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 383 572 277 106 264 308
Base content per 1 kb (bases) 401 598 290 111 276 322
Base content (%) 40.1% 59.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 371 671 292 79 284 387
Base content per 1 kb (bases) 356 644 280 76 273 371
Base content (%) 35.6% 64.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 138 208 99 39 100 108
Base content per 1 kb (bases) 399 601 286 113 289 312
Base content (%) 39.9% 60.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 549 829 400 149 391 438
Base content per 1 kb (bases) 398 602 290 108 284 318
Base content (%) 39.8% 60.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 181 78 38 90 91
Base content per 1 kb (bases) 391 609 263 128 303 306
Base content (%) 39.1% 60.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 716 1105 519 197 497 608
Base content per 1 kb (bases) 393 607 285 108 273 334
Base content (%) 39.3% 60.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 184 344 151 33 114 230
Base content per 1 kb (bases) 348 652 286 63 216 436
Base content (%) 34.8% 65.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 7 5 10 15 3 11 8 1 1 1 6 0 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 8 8 0 1 3 6 1 2 6 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 3 1 5 0 0 4 0 2 1 0 1 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 4 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 66 78 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 63 37 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 68 98 46
ATP8 (size: 198 bases)
Amino acid sequence: MPQLDTSTWFTTILSMFLALFIIFQLKISKYNFYHNPESAAKVLKHITPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (4.62%)
Serine (Ser, S)
n = 4 (6.15%)
Threonine (Thr, T)
n = 7 (10.77%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.54%)
Leucine (Leu, L)
n = 11 (16.92%)
Isoleucine (Ile, I)
n = 6 (9.23%)
Methionine (Met, M)
n = 2 (3.08%)
Proline (Pro, P)
n = 5 (7.69%)
Phenylalanine (Phe, F)
n = 5 (7.69%)
Tyrosine (Tyr, Y)
n = 3 (4.62%)
Tryptophan (Trp, W)
n = 3 (4.62%)
Aspartic acid (Asp, D)
n = 1 (1.54%)
Glutamic acid (Glu, E)
n = 2 (3.08%)
Asparagine (Asn, N)
n = 2 (3.08%)
Glutamine (Gln, Q)
n = 2 (3.08%)
Histidine (His, H)
n = 2 (3.08%)
Lysine (Lys, K)
n = 6 (9.23%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 1 1 1 6 0 3 2 0 0 0 1 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 2 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 0 3 1 0 0 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 23 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 19 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 14 35 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 26 10 5 30 3 8 5 1 6 6 18 5 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 8 15 17 0 6 10 27 4 9 10 8 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 18 0 8 5 13 1 1 2 6 13 1 3 8 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 2 5 11 9 0 0 2 4 2 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 107 142 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 154 207 123
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 12 3 2 15 3 10 6 0 7 1 5 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 1 6 0 3 1 4 0 2 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 4 3 8 1 1 4 6 4 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 3 7 6 0 2 0 4 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 55 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 52 110 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 5 10 4 12 0 7 6 1 4 5 5 2 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 7 3 0 5 7 7 1 1 5 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 2 6 6 1 1 4 7 4 0 1 4 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 1 3 2 0 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 67 59 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 87 92 72
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 20 (5.28%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 22 19 5 15 26 3 6 4 2 1 8 8 1 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 2 6 15 1 0 6 16 1 5 4 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 0 3 4 10 1 0 3 8 7 2 0 6 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 4 7 9 0 0 1 7 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 98 119 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 92 77 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 133 167 66
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 12 17 5 10 29 2 7 7 0 1 3 9 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 10 12 1 0 5 7 0 2 12 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 5 13 0 0 3 4 8 0 2 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 86 93 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 101 158 52
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 38 3 14 29 0 10 9 0 1 3 4 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 7 5 0 1 4 8 1 1 7 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 4 6 13 2 0 2 4 4 0 0 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 85 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 105 178 58
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 38 3 14 29 0 10 9 0 1 3 4 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 7 5 0 1 4 8 1 1 7 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 4 6 13 2 0 2 4 4 0 0 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 85 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 105 178 58
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 21 33 17 15 43 6 12 10 1 3 6 5 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 11 12 1 1 8 7 2 4 7 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 2 8 9 9 1 1 10 7 8 0 1 4 19 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 1 3 10 1 3 1 5 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 137 158 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 112 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 151 195 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 9 1 3 10 2 5 2 0 1 0 5 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 3 5 0 1 1 1 1 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 2 5 2 0 0 1 2 2 0 1 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 32 45 14
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 44 (7.26%)
Serine (Ser, S)
n = 45 (7.43%)
Threonine (Thr, T)
n = 56 (9.24%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 20 (3.3%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 57 (9.41%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 30 34 8 19 44 2 15 16 3 6 7 7 0 18 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 3 6 16 20 2 0 10 16 2 3 11 10 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 27 2 7 13 15 1 4 5 11 8 0 0 9 28 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 1 2 8 21 2 0 4 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 138 221 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 161 134 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 220 253 113
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 6 1 0 0 0 11 1 0 13 0 4 8 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 1 0 1 13 0 2 11 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 5 0 0 2 5 0 9 1 1 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 4 0 3 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 6 48 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 3 34 94
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 269 (7.08%)
Threonine (Thr, T)
n = 319 (8.4%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 181 (4.77%)
Leucine (Leu, L)
n = 596 (15.7%)
Isoleucine (Ile, I)
n = 338 (8.9%)
Methionine (Met, M)
n = 256 (6.74%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 244 (6.43%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 162 (4.27%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
188 149 213 75 104 270 25 107 79 9 45 40 79 17 110 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 6 17 43 89 108 6 31 55 104 24 35 70 87 2 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 165 8 47 58 99 12 13 40 65 66 6 13 47 115 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 77 18 22 45 92 6 9 12 40 3 1 0 5 2 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
803 918 1224 845
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
459 973 746 1612
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
194 1152 1624 820

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.