Viewing data for Bubalus bubalis


Scientific name Bubalus bubalis
Common name Water buffalo
Maximum lifespan 34.90 years (Bubalus bubalis@AnAge)

Total mtDNA (size: 16359 bases) GC AT G C A T
Base content (bases) 6657 9702 4371 2286 4305 5397
Base content per 1 kb (bases) 407 593 267 140 263 330
Base content (%) 40.7% 59.3%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4669 6669 3211 1458 3053 3616
Base content per 1 kb (bases) 412 588 283 129 269 319
Base content (%) 41.2% 58.8%
D-loop (size: 910 bases) GC AT G C A T
Base content (bases) 381 529 244 137 252 277
Base content per 1 kb (bases) 419 581 268 151 277 304
Base content (%) 41.9% 58.1%
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 573 939 338 235 410 529
Base content per 1 kb (bases) 379 621 224 155 271 350
Base content (%) 37.9% 62.1%
Total rRNA-coding genes (size: 2524 bases) GC AT G C A T
Base content (bases) 1004 1520 561 443 578 942
Base content per 1 kb (bases) 398 602 222 176 229 373
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 397 558 223 174 212 346
Base content per 1 kb (bases) 416 584 234 182 222 362
Base content (%) 41.6% 58.4%
16S rRNA gene (size: 1569 bases) GC AT G C A T
Base content (bases) 607 962 338 269 366 596
Base content per 1 kb (bases) 387 613 215 171 233 380
Base content (%) 38.7% 61.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 277 404 197 80 187 217
Base content per 1 kb (bases) 407 593 289 117 275 319
Base content (%) 40.7% 59.3%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 74 127 59 15 46 81
Base content per 1 kb (bases) 368 632 294 75 229 403
Base content (%) 36.8% 63.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 665 880 401 264 445 435
Base content per 1 kb (bases) 430 570 260 171 288 282
Base content (%) 43.0% 57.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 276 408 169 107 182 226
Base content per 1 kb (bases) 404 596 247 156 266 330
Base content (%) 40.4% 59.6%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 352 429 228 124 224 205
Base content per 1 kb (bases) 451 549 292 159 287 262
Base content (%) 45.1% 54.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 501 639 342 159 285 354
Base content per 1 kb (bases) 439 561 300 139 250 311
Base content (%) 43.9% 56.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 404 553 285 119 248 305
Base content per 1 kb (bases) 422 578 298 124 259 319
Base content (%) 42.2% 57.8%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 400 644 294 106 270 374
Base content per 1 kb (bases) 383 617 282 102 259 358
Base content (%) 38.3% 61.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 148 198 101 47 97 101
Base content per 1 kb (bases) 428 572 292 136 280 292
Base content (%) 42.8% 57.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 539 839 384 155 399 440
Base content per 1 kb (bases) 391 609 279 112 290 319
Base content (%) 39.1% 60.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 119 178 75 44 94 84
Base content per 1 kb (bases) 401 599 253 148 316 283
Base content (%) 40.1% 59.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 738 1083 535 203 483 600
Base content per 1 kb (bases) 405 595 294 111 265 329
Base content (%) 40.5% 59.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 155 41 115 217
Base content per 1 kb (bases) 371 629 294 78 218 411
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 11 7 8 19 3 7 8 1 2 2 6 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 6 5 0 1 4 6 0 1 4 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 1 2 5 0 2 5 1 1 0 1 4 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 3 1 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 69 81 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 67 100 48
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLALFIIFQLKISKHSFHHNPEPTPTKMPKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 8 (12.12%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 3 (4.55%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 3 1 1 3 0 4 2 1 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 1 2 4 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 2 0 0 3 1 0 1 1 0 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 19 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 19 36 5
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 26 6 7 24 9 9 6 0 7 10 19 2 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 10 12 16 2 9 10 20 8 11 7 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 4 9 14 1 0 3 6 13 2 3 6 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 10 6 8 1 1 2 5 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 105 140 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 162 199 116
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 10 4 2 15 6 6 6 0 3 4 4 1 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 1 1 6 0 2 2 3 1 2 3 4 4 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 2 3 6 7 0 1 4 8 3 1 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 4 5 5 4 2 1 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 59 69 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 55 96 49
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 16 (6.18%)
Serine (Ser, S)
n = 20 (7.72%)
Threonine (Thr, T)
n = 23 (8.88%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.79%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 15 (5.79%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 11 (4.25%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 3 (1.16%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 8 (3.09%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 16 (6.18%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 7 6 5 14 2 4 6 1 3 4 6 2 3 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 11 2 0 2 9 6 3 3 4 3 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 2 4 3 8 0 1 4 7 4 1 1 2 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 1 2 2 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 66 63 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 97 87 58
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 25 13 2 17 29 5 6 5 1 3 4 7 2 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 2 6 19 0 1 5 14 4 4 4 14 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 1 3 6 11 0 2 2 5 11 2 0 3 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 0 10 8 1 0 0 6 2 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 101 113 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 94 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 147 164 46
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 24 (7.55%)
Threonine (Thr, T)
n = 19 (5.97%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 54 (16.98%)
Isoleucine (Ile, I)
n = 31 (9.75%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 17 0 11 31 2 10 7 0 1 2 6 4 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 2 11 16 0 0 8 5 0 3 9 10 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 8 12 0 0 3 3 9 3 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 2 1 2 6 1 0 1 6 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 84 92 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 110 157 36
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 46 (13.26%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 39 2 8 27 7 7 9 1 3 3 6 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 1 9 6 1 1 4 8 1 2 7 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 2 2 9 15 1 0 2 2 6 1 3 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 0 10 1 0 0 2 1 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 82 147 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 110 169 41
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 46 (13.26%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 39 2 8 27 7 7 9 1 3 3 6 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 1 9 6 1 1 4 8 1 2 7 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 2 2 9 15 1 0 2 2 6 1 3 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 0 10 1 0 0 2 1 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 82 147 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 110 169 41
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 21 29 14 10 41 6 20 10 1 4 2 9 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 2 4 12 12 0 1 7 8 2 7 4 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 0 10 11 8 0 1 10 7 8 2 3 3 20 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 3 1 3 10 1 1 1 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 124 159 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 114 84 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 146 197 89
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 9 4 1 12 3 2 1 0 1 2 4 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 3 4 1 2 0 1 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 2 6 0 0 0 1 3 1 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 25 27 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 28 40 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 45 (7.43%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 86 (14.19%)
Isoleucine (Ile, I)
n = 62 (10.23%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 38 (6.27%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 41 35 9 18 38 5 12 15 4 1 9 9 0 19 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 2 21 20 0 1 12 15 0 5 13 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 28 3 9 10 14 0 2 10 6 11 1 4 10 28 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 1 10 20 2 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 136 228 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 156 131 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 243 241 97
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 5 1 0 1 1 11 1 0 11 3 3 8 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 4 0 0 2 7 1 3 15 2 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 3 1 3 0 4 0 7 2 3 5 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 4 0 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 8 45 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 9 38 81
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 251 (6.61%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 306 (8.05%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 188 (4.95%)
Leucine (Leu, L)
n = 593 (15.61%)
Isoleucine (Ile, I)
n = 326 (8.58%)
Methionine (Met, M)
n = 269 (7.08%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 241 (6.34%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
150 176 209 60 94 266 52 98 79 10 40 45 80 23 99 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
60 5 19 36 100 109 6 27 62 91 36 45 57 84 8 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
93 157 16 42 72 103 3 13 47 59 69 17 23 44 122 23
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 72 23 23 44 84 11 4 13 42 4 1 0 8 1 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 913 1223 847
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
468 971 744 1617
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
293 1227 1570 710

>NC_006295.1 Bubalus bubalis mitochondrion, complete genome
ACTAATGTCTAATCAGCCCATGCTCACACATAACTGTGCTGTCATACATTTGGTATTTTTTTATTTTGGG
GGATGCTTGGACTCAGCTATGGCCGTCAAAGGCCCCGACCCGGAGCATGAATTGTAGCTGGACTTAACTG
CATCTTGAGCACCAGCATAATGGTAGGCATGGGACATTGCAGTCAATGGTTACAGGACATAAATATATTA
TTTATTTTTCCCCCCCTCCTATCAAACCCCCCCCTTAAATACTTACCACCATTTTTAACATGCTTCTCCC
TAGATGCTTATTCGAACTTATCACATTTCCAATACTCAAATCAGCACTCCAAATAAAGTAACTATATAAG
CACCCAACCCATCACTTCACAACACAGTTAATGTAGCTTAAAACCAAAGCAAGGCACTGAAAATGCCTAG
ATGAGTTCTCCCAACTCCATAAACACATAGGTTTGGTCCCAGCCTTCCTGTTAACTCTTAATAAACTTAC
ACATGCAAGCATCCGCATCCCGGTGAGAATGCCCTCTAGGTCAACGAAACTAAGAGGAGCGGGCATCAAG
CACACACCTGTAGCTCACGACGCCTTGCTTAACCACACCCCCACGGGAAACAGCAGTGACAAAAATTAAG
CCATAAACGAAAGTTTGACTAAGTTATATTAGCTAAGGGTTGGTAAATCTCGTGCCAGCCACCGCGGTCA
TACGATTAACCCAAGCTAACAGGAGTACGGCGTAAAATGTGTTAAAGCACACCGCTAAATAGAGTTAAAT
TTTAATTAAGCCGTAAAAAGCCATAATTTCAATAAAAATAAGCAACGAAAGTGACTCTATAACAGCTGAC
ACACTATAGCTAAGACCCAAACTGGGATTAGATACCCCACTATGCTTAGCCCTAAACACAAATAATTATA
TTAACAAAATTATTCGCCAGAGTACTACCGGCAATAGCCTAAAACTCAAAGGACTTGGCGGTGCTTTATA
TCCCCCTAGAGGAGCCTGTTCTATAATCGATAAACCCCGATAGACCTCACCAATTCTTGCTAATGCAGTC
TATATACCGCCATCTTCAGCAAACCCTAAAAAGGTACAAAAGTAAGCGCAATCACAATGCATAAAAACGT
TAGGTCAAGGTGTAACCTATGAAATGGGAAGAAATGGGCTACATTTTCTACACCAAGAATACCCAACACG
AAAGTTATTATGAAAGTTAATAACCAAAGGAGGATTTAGCAGTAAACTAAGAATAGAGTGCTTAGTTGAA
CTAGGCCATGAAGCACGCACACACCGCCCGTCACCCTCCTCAAGTAAATATAATGCATCCAACCCTATTT
AAATGCACTAACCACATGAGAGGAGACAAGTCGTAACAAGGTAAGCATACTGGAAAGTGTGCTTGGATAA
ATCAAGATATAGCTTAAATAAAGCATCCAGTTTACACCTAGAAGATTTCACACACCATGAATATCTTGAA
CTAAATCTAGCCCAAAACCCCCACCCCAACAAATAATTAAGATAAAATAAAACAAAACATTTACCCCAAA
CTAAAGTATAGGAGATAGAAATATTAAATACGGCGCTATAGAGAGAGTACCGCAAGGGAACGATGAAAGA
AAAATCAAAAGTACAAAAAAGCAAAGGTTACCCCTTGTACCTCTTGCATAATGAATTAACTAGTACAAAC
TTAACAAAACGAATTTTAGTTAAGTAACCCGAAACCAGACGAGCTACTTACAAACAGTTTACCAAGAACT
AACTCGTCTATGTGGCAAAATAGTGAGAAGATTTGTAAGTAGTGGTGACATGCCTAACGAGCCTGGTGAT
AGCTGGTTGTCCAGAAAATGAATCTTAGTTCAGCTTTAAAGATACCAAAAGTCCAAATAAACCTCACTGT
ATCTTTAAAAGTTAATCTAAAAAGGTACAGCCTTTTAGAAACGGATACAACCTTAGCTAGAGAGTAAGAT
CTAACAATACCATAGTAGGCCCAAAAGCAGCCACCAATTAAGAAAGCGTTAAAGCTCAACAATAAAAACT
CCATAAATTCCAAAAATAGACAACCAACTCCTAACCCTAATACTGGACTAATCTATTGCAAAATAGAAGC
AATAATGTTAATATGAGTAACAAGAAACACTTTCTCCTTGCATAAGTTTAAGTCAGTATCTGATAATACC
CTGACCATTAACAGCTAATAAAAATAGTCCAATAATAAATAATTTATTTATTACACTGTTAATCCAACAC
AGGAATGCACCAAGGAAAGATTAAAAGAAGTAAAAGGAACTCGGCAAACACAAACCCCGCCTGTTTACCA
AAAACATCACCTCCAGCATCCCTAGTATTGGAGGCACTGCCTGCCCAGTGACAACCGTTAAACGGCCGCG
GTATCCTGACCGTGCAAAGGTAGCATAATCACTTGTTCTCTAAATAGGGACTCGTATGAATGGCCACACG
AGGGTTTTACTGTCTCTTACTTCCAATCAGTGAAATTGACCTTCCCGTGAAGAGGCGGGAATGCACTAAT
AAGACGAGAAGACCCTATGGAGCTTTAACTAATCAGCCCAAAGAAAAACAAACCAAACCACTAAGGAGTA
ACAACACTCTTCATGAGCTGACAGTTTCGGTTGGGGTGACCTCGGAGAATAAAAAATCCTCCGAGCGATT
TTAAAGACTAGACCTACAAGTCAAATCGCTCTATCGCTCATTGATCCAAAAATTTTGATCAACGGAACAA
GTTACCCTAGGGATAACAGCGCAATCCTATTCAAGAGTCCATATCGACAATAGGGTTTACGACCTCGATG
TTGGATCAGGACACCCTGATGGTGCAACCGCTATCAAAGGTTCGTTTGTTCAACGATTAAAGTCCTACGT
GATCTGAGTTCAGACCGGAGTAATCCAGGTCGGTTTCTATCTATTACGTATTTCTCCCAGTACGAAAGGA
CAAGAGAAATAAGGCCAACTTAAAATTAAGCGCCTTAAAACAACTAATGAATTTATCTCAATTAGTAACG
CAACAAACCTGCCCTAGAAAAGGGCTTAGTTAAGGTGGCAGAGCCCGGTAATTGCATAAAACTTAAACTT
TTATATCCAGAGATTCAAATCCTCTCCTTAACAAAATGTTCATAATCAATATCCTAATACTAATTATTCC
TATCCTATTAGCAGTGGCATTCCTCACATTAGTAGAACGAAAAGTGCTAGGCTACATACAATTTCGGAAA
GGCCCAAATGTTGTAGGCCCATACGGCCTACTCCAACCCATCGCCGATGCAATTAAACTCTTCATCAAAG
AACCACTACGACCCGCCACATCCTCAGCCTCAATGTTTATTTTAGCACCTATCTTAGCCCTAGGCCTAGC
CCTAACCATATGAATTCCCCTACCCATACCCTACCCCCTCATCAACATAAACCTAGGAGTCCTATTTATA
CTAGCCATATCAAGCTTAGCTGTGTATTCTATCCTCTGATCAGGCTGGGCCTCCAACTCAAAATACGCAC
TAATCGGAGCCCTACGAGCAGTAGCACAAACAATTTCATACGAAGTAACACTAGCTATTATCCTACTGTC
AGTGCTCCTAATAAGCGGATCCTTCACCCTCTCCACACTAATCATCACACAAGAACAAACATGGCTAATT
TTCCCAGCATGGCCACTGGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCCCCATTTG
ACCTCACCGAAGGAGAATCAGAACTAGTCTCAGGCTTCAACGTAGAGTACGCAGCAGGCCCATTCGCCCT
ATTCTTCATAGCAGAGTACGCAAACATTATCATAATAAACATTTTCACAGCAATCCTATTCCTAGGAACA
TCCCACAACCCATACATGCCAGAACTCTATACAATCAACTTTACCATTAAGTCCCTATTACTCACAATCT
CCTTTCTATGAATCCGAGCATCCTATCCTCGATTCCGCTACGACCAATTAATACACTTACTATGAAAAAA
TTTTTTACCCTTAACACTAGCCATATGTATATGACACGTATCACTACCCATTCTCCTATCAAGCATTCCC
CCACAAACATAAGAAATATGTCTGACAAAAGAGTTACTTTGATAGAGTAAATAATAGAGGTTTAAACCCT
CTTATTTCTAGAACTATAGGAATTGAACCTAATCCTAAGAACCCAAAACTCTTCGTGCTCCCAATTACAC
CAAGTCCTAATAGTAAGGTCAGCTAATTAAGCTATCGGGCCCATACCCCGAAAATGTTGGTTCACATCCT
TCCCGTACTAATAAACCCAATCATCTTTTTTATTATTCTATCAACTGTTATAATAGGAACTATCATCGTT
ATAATTAGCTCCCACTGACTACTCATCTGAATCGGATTTGAAATAAACATACTCGCCATCATTCCCATTA
TAATGAAAAATCACAACCCACGGGCCACGGAAGCATCAACTAAGTACTTCCTAACCCAATCAACAGCCTC
AATATTATTAATAATAGCCGTCATTATCAACCTGATATTCTCAGGCCAATGGACCGTAATAAAATTATTT
AACCCAGTAGCCTCAATGCTCATAACAATAGCCCTCGCCATAAAACTGGGAATAGCCCCATTTCACTTTT
GAGTCCCAGAAGTAACACAAGGTATCCCCCTGTCCTCTGGCCTAATCTTGCTAACATGACAAAAACTAGC
ACCCATATCCGTACTATACCAAATCTCCCCATCAATCAATCTAAACCTGATCCTAACCATGTCAATGTTA
TCAATTATAATCGGAGGCTGAGGAGGACTAAACCAAACACAGTTGCGAAAAATCATAGCCTACTCATCAA
TTGCGCACATAGGCTGAATAACAGCAGTACTACCATATAACCCCACCATAACACTACTAAACCTAACCAT
CTACATCATCATAACCTCAACCATATTTATACTATTCATAGCTAACTCCACCACCACCACCCTGTCACTA
TCACATACGTGAAACATGATGCCTATCATAACCGTCTTAATTCTCATAACCCTTCTATCAATAGGAGGGC
TCCCTCCCCTGTCGGGATTTATACCAAAATGAATGATCATCCAAGAGATAACAAAAAACGATAGCATTAT
CTTACCCACCCTAATAGCAATCACAGCACTATTAAACTTGTATTTCTACATACGACTCGCATACTCCACC
ACACTAACAATATTTCCCTCTACAAACAATATAAAAATAAAATGACAATTTTCCCTTACAAAACAAACAA
CCCTCCTACCAACAATAGTTGTACTATCCACCATACTACTACCACTAACACCAATACTATCCCTGCTAGA
ATAGGAATTTAGGTTAAACAGACCAAGAGCCTTCAAAGCCCTAAGCAAGTACAATTTACTTAATTCCTGA
TAAGGATTGCAAGACTATATCTTACATCAATTGAATGCAAATCAACCACTTTAATTAAGCTAAATCCTCA
CTAGACTGGTGGGCTCCACCCCCACGAAACTTTAGTTAACAGCTAAATGCCCTAATCAACTGGCTTCAAT
CTACTTCTCCCGCCGCGAGAAAAAAAAGGCGGGAGAAGCCCCGGCAGAATTAAAGCTGCTTCTCTGAATT
TGCAATTCAACGTGTAAATTCACCACAAGGCCTGGTAAAAAGAGGACTCAAACCTCTGTCTTTAGATTTA
CAGTCTAATGCTCACTCAGCCATTTTACCCATGTTCATTAACCGCTGATTATTCTCAACCAACCATAAAG
ATATCGGCACCCTGTACTTGCTATTTGGTGCCTGAGCCGGCATAGTAGGGACAGCCCTAAGCCTGCTGAT
TCGCGCTGAATTAGGTCAACCTGGGACCCTACTCGGAGATGACCAAATCTACAACGTAGTTGTAACCGCA
CACGCATTTGTAATAATTTTCTTCATAGTAATGCCAATCATAATTGGGGGATTTGGCAACTGACTTGTCC
CTCTAATAATTGGCGCTCCCGACATAGCATTCCCCCGAATGAACAATATAAGCTTCTGACTCCTCCCTCC
CTCTTTCCTACTACTCCTAGCATCATCCATAGTTGAAGCTGGAGCAGGGACAGGTTGGACCGTATACCCC
CCTTTAGCAGGTAACCTAGCCCACGCAGGAGCTTCGGTAGATCTAACCATCTTCTCTCTGCACTTGGCAG
GTGTCTCCTCAATTTTAGGGGCTATTAATTTTATTACAACAATTATCAACATAAAACCTCCTGCAATATC
ACAATACCAAACCCCCTTATTCGTATGATCCGTAATAATCACCGCCGTGCTATTACTCCTTTCACTTCCT
GTACTAGCAGCTGGCATCACAATGCTACTAACAGATCGAAACCTAAACACAACTTTCTTTGATCCAGCGG
GGGGAGGAGATCCTATTCTATACCAACACTTATTTTGATTCTTCGGGCACCCTGAAGTATATATTCTTAT
TTTACCCGGATTCGGTATAATCTCCCACATTGTAACCTACTACTCAGGAAAAAAGGAACCATTTGGATAC
ATAGGAATAGTTTGAGCCATAATATCAATTGGGTTCCTGGGCTTTATCGTATGGGCCCACCACATATTTA
CAGTTGGAATAGACGTCGATACACGAGCCTACTTCACATCAGCCACTATGATTATTGCTATCCCAACTGG
AGTAAAAGTCTTTAGCTGACTAGCAACACTTCACGGAGGTAATATCAAATGATCTCCCGCTATAATGTGA
GCCCTAGGCTTTATCTTCCTTTTTACAGTAGGAGGCTTGACCGGAATTGTCCTAGCTAACTCCTCCCTCG
ACATCGTTCTCCACGACACGTACTATGTTGTAGCACACTTCCACTATGTCCTATCAATAGGAGCTGTGTT
CGCCATTATAGGAGGATTTGTACATTGATTTCCACTGTTCTCAGGCTATACCCTAAACGACACTTGAGCC
AAAATCCACTTCGCAATCATATTCGTAGGTGTCAATATGACTTTCTTTCCACAACACTTCTTAGGACTGT
CCGGTATACCACGACGTTACTCCGATTACCCAGATGCATACACAATATGAAATACCATTTCATCAATGGG
CTCATTTATTTCTCTGACAGCGGTCATACTAATAGTCTTTATCATCTGAGAAGCATTCGCATCCAAACGA
GAAGTCTCAACCGTAGATCTAACCACAACAAACCTGGAATGACTAAATGGATGCCCTCCACCATATCATA
CATTTGAAGAACCTACGTATGTTAACCTAAAATAAGAAAGGAAGGAATCGAACCCCCTATTATTGGTTTC
AAGCCAACATCATAGCCACTATGTCTCTCTCAATTAACGAGATGTTAGTAAAAACATTATATAACTTTGT
CGAAGTTAAGTTACAAGTGAGAACCCTGTACATCTCATATGGCATACCCTATACAACTAGGCTTTCAAGA
TGCAACATCTCCGATCATAGAAGAACTGCTTCACTTTCATGACCATACGCTAATAATCGTCTTTTTAATT
AGCTCATTAGTCCTTTATATCATTTCACTAATACTAACAACAAAACTAACTCACACCAGTACAATAGATG
CACAAGAAGTAGAGACAATTTGAACCATTCTACCCGCTATTATCCTGATTTTAATTGCACTCCCGTCCCT
ACGAATTCTATATATAATGGATGAAATCAACAACCCATCCCTCACAGTAAAAACCATGGGACACCAATGA
TACTGAAGCTATGAATATACAGATTATGAAGACCTGAGCTTCGACTCCTACATGATTCCAACGTCAGAGT
TAAAGCCAGGAGAACTACGACTACTAGAAGTTGATAATCGAGTTGTACTACCCATGGAGATGACAATCCG
AATACTGGTCTCCTCCGAAGACGTGTTACACTCATGGGCCGTACCCTCCCTGGGGTTAAAAACAGACGCA
ATCCCGGGTCGTCTGAACCAAACAACCCTTATGTCTACCCGACCAGGCCTATATTATGGTCAATGCTCAG
AAATCTGCGGATCAAACCACAGCTTTATACCTATTGTCCTTGAGATAGTTCCGCTAAAGTATTTTGAAAA
ATGATCTGCATCAATACTATAAAATCACCAAGAAGCTGTACCAGCACTAGCCTTTTAAGTTAGAGATAGG
GAGCATTATACTCTCCTTGGTGACATGCCACAGTTAGACACATCAACATGACTAACGATAATCTTATCAA
TATTCTTAGCCCTCTTCATCATCTTTCAACTAAAAATTTCGAAACACAGCTTCCACCACAACCCAGAACC
GACACCAACAAAAATACCAAAACAAAACACCCCCTGAGAAACAAAATGAACGAAAATCTATTTGCCTCTT
TCATTACCCCTATAATTCTAGGCCTCCCCCTCGTAACTCTTATCGTACTATTCCCCAGCTTACTGTTCCC
AACTCCAAATCGACTAATAAGTAACCGCCTCATTTCCCTCCAACAATGAATACTTCAACTTGTATCAAAA
CAAATAATGAGTATCCACAATACCAAGGGACAAACATGAACATTAATACTAATATCCTTAATTTTATTTA
TTGGATCAACAAACCTACTAGGTCTACTACCCCACTCATTCACACCAACTACACAACTATCAATAAATCT
AGGCATAGCTATCCCCCTATGAGCAGGCGCCGTAGTTACAGGCTTCCGCAACAAAACTAAAGCATCACTC
GCCCATTTTCTACCACAGGGAACACCAACCCCATTGATCCCAATGCTAGTTATTATCGAGACTATCAGCC
TTTTTATTCAACCAGTGGCTCTCGCCGTACGACTAACAGCCAACATTACTGCAGGACACCTGTTAATTCA
TCTAATCGGAGGAGCTACACTTGCACTAATAAGCATCAGCATAACAACAGCTCTCATTACATTCATCATC
TTAGTCCTTCTTACAATTCTAGAATTTGCAGTGGCTATAATCCAAGCCTACGTATTCACCCTCCTAGTCA
GCTTATATCTGCACGACAACACATAATGACACACCAAACTCATGCTTACCACATAGTAAACCCAAGCCCT
TGACCTCTTACGGGAGCCTTATCCGCCCTATTAATAACATCCGGCTTAATTATATGATTCCACTTCAACT
CAACAGCCCTACTAATGCTTGGCTTGACAACTAATATACTTACAATATATCAATGATGGCGAGATATTAT
CCGAGAGAGCACTTTCCAAGGACACCACACCTCAGCCGTTCAAAAAGGCCTCCGCTATGGAATAATTCTC
TTCATTATTTCTGAAGTCCTATTCTTCACCGGATTCTTCTGAGCATTCTACCACTCAAGTCTTGCCCCCA
CACCCGAACTGGGCGGTTGCTGACCCCCAACAGGCATTAATCCGCTCAACCCCCTGGAAGTTCCACTACT
CAACACCTCCGTTCTATTAGCTTCAGGAGTCTCTATCACCTGAGCCCACCATAGCCTAATAGAAGGGAGC
CGAAACCATATGCTACAGGCCCTATTTATTACCATTACGCTAGGAGTGTATTTCACACTACTACAAGCCT
CAGAATACTATGAAGCACCTTTCACTATTTCAGACGGGGTGTACGGCTCAACTTTCTTCGTAGCCACAGG
CTTCCACGGTCTTCATGTAATTATTGGGTCTACCTTCCTAATTGTCTGCTTCTTCCGCCAACTAAAATTC
CATTTCACCTCTAACCACCATTTCGGCTTTGAGGCCGCTGCCTGATATTGACACTTTGTAGACGTAGTCT
GACTTTTCCTCTATGTATCAATCTATTGATGAGGCTCATATTCTTTTAGTATCAAGCAGTACAGCTGACT
TCCAATCAGCTAGTTTCGGTCTAACCCGAAAAAGAATAATAAACCTGATACTAGCCCTCCTAACTAACTT
TACACTAGCCACCCTACTTGTTATCATCGCATTCTGACTCCCTCAACTAAATGCATATTCAGAAAAAACA
AGCCCATATGAGTGCGGATTTGACCCTATAGGGTCAGCCCGCCTTCCTTTCTCCATAAAATTTTTCCTAG
TAGCCATTACATTCCTCCTATTTGACCTAGAAATTGCACTCCTCCTTCCACTACCGTGAGCCTCACAAAC
AACCAACTTGAATACAATACTTACCATGGCCCTCTTCCTGATCATTCTGCTAGCTGTGAGCCTAGCCTAT
GAATGAACTCAAAAGGGACTAGAATGGACTGAATATGGTATTTAGTTTAAAATAAAATAAATGATTTCGA
CTCATTAGATTATGATCAAACTCATAATTACCAAATGTCCCTAGTATACATAAATATTATAATAGCATTC
GCAGTCTCTCTTGTAGGGTTGCTAATATATCGATCCCACCTAATATCCTCCCTCCTATGCCTAGAAGGAA
TGATACTGTCCCTATTCGTTATGGCTGCCCTAACAATTCTTAATTTACACTTCACGCTAGCCAGCATAAT
ACCTATCATCTTACTGGTCTTCGCAGCCTGCGAAGCGGCACTAGGTCTATCTCTGCTAGTAATAGTATCC
AACACATATGGTACTGACTATGTGCAAAATCTTAACCTACTTAAATGCTAAAGTACATCATCCCAACAAT
AATACTTATACCTCTGACCTGATTATCAAAAAACAACATAATCTGGATTAACTCTACAGCCCACAGCCTG
CTAATTAGCCTTACAAGCTTACTCCTTATAAATCAATTCGGCGACAACAGCCTCAACTTTTCATTAGTAT
TTTTCTCTGATTCTTTATCCACTCCACTATTGATTCTAACTATGTGACTCCTCCCCCTAATATTAATAGC
CAGCCAACACCACTTATCAAAAGAAAACCTAACCCGAAAAAAACTATTTATCACCATACTAATCCTACTA
CAATTGTTCCTAATCATGACCTTCACTGCCATAGAACTAATCTTCTTCTATATTCTATTCGAAGCAACAC
TAGTTCCAACACTTATTATCATCACCCGATGAGGAAACCAAACAGAGCGTCTAAACGCCGGACTTTACTT
CTTATTCTACACACTTACAGGCTCCTTACCTTTGCTAGTTGCACTAGTCTACATTCAAAGCACAATAGGG
TCCCTAAACTTCCTAATACTCCAGTACTGAACACAACCTATATCTAACTCTTGATCTAATATCTTCATAT
GGTTAGCATGTATGATGGCTTTTATAGTAAAAATACCACTATATGGCCTTCACCTTTGACTACCTAAAGC
CCATGTAGAAGCCCCTATTGCAGGTTCCATGGTTCTTGCAGCAATCCTATTAAAACTGGGAGGATATGGC
ATGCTACGAATCACATTACTCTTAAACCCAGTAACTGACTTCATAGCATATCCATTTATCATACTATCCT
TATGAGGCATAATTATGACCAGCTCAATTTGCCTTCGCCAAACAGACCTGAAATCCCTCATTGCATATTC
TTCTGTAAGCCATATAGCACTTGTTATTGTAGCCATCCTTATTCAAACACCCTGAAGTTATATAGGAGCT
ACCGCCCTAATAATTGCCCATGGCCTCACATCCTCTATACTTTTCTGCCTAGCAAACTCCAACTACGAGC
GAGTCCACAGCCGAACTATAATCTTAGCTCGAGGCCTACAAACCCTACTTCCACTAATAGCCACTTGATG
ACTACTAGCTAGCCTAACCAACCTAGCCCTGCCCCCTACAATTAACCTAATCGGAGAGTTATTAGTAGTA
ATATCAACCTTTTCATGATCCAACACCACAATCATCCTAATGGGAGCAAACATAGTAATTACTGCCTTAT
ACTCCTTATATATACTAATCATAACCCAACGAGGAAAACACACCCACCACATCAACAACATTTCACCATC
CTTCACACGAGAAAATGCACTCATATCATTACATATCCTACCTCTATTACTCCTATCTCTAAACCCAAAA
ATTATTCTAGGGCCCCTGTACTGTGAATATAGTTTAACAAAAACATTAGACTGTGAATCTAACAATAGAA
GCCCACTTGCCTTCTTATTTACCGAAAAAGCACGCAAGAACTGCTAATTCTATGCCCCCATGCCTAACAG
TATGGCTTTTTCAAACTTTTAAAGGATGGTAGTTATCCGTTGGTCTTAGGAGCCAAAAAATTGGTGCAAC
TCCAAATAAAAGTAATAAACATATTCCCTTCACTTATACTAACCACCTTGTTTTTATTAACATTACCCAT
CATAATAACAAGCCTCAACACCCATAAAAACCCCAATTACCCATTCTACGTAAAAACAGCCATTTCATGC
GCCTTCATTACCAGCATAATCCCCACAATAATATTTATCCATACAGGACAAGAAATAATCATTTCAAATT
GACACTGATTGACCATCCAAACTCTCAAATTATCACTCAGCTTTAAAATAGATTATTTTTCAATAATATT
CGTCCCAGTAGCACTATTCGTTACATGATCTATTATAGAATTCTCAATATGATACATACACTCAGACCCC
AACATTAATCAATTCTTTAAATACCTACTCCTGTTTCTTATCACAATACTCATTCTTGTCACTGCAAACA
ACCTCTTCCAACTATTTATTGGCTGAGAAGGCGTCGGAATTATATCATTCTTACTCATCGGATGATGGCA
CGGACGAGCAGACGCAAACACAGCAGCCCTACAAGCAATCCTGTATAACCGCATCGGCGACATCGGATTT
ATCCTAGCAATAGCATGATTCCTAGCAAATCTTAACACCTGAGACCTCCAACAAATCTTCATACTAAACC
CAGACAACTCTAACGTACCCCTAATAGGACTAGTACTAGCCGCAACAGGAAAATCCGCTCAATTTGGCCT
CCACCCATGACTCCCCTCTGCAATGGAAGGCCCAACTCCTGTCTCAGCACTACTCCACTCAAGTACAATA
GTAGTAGCAGGCATCTTCCTATTAATCCGCTTCTACCCACTAACAGAAAACAACAAATTTATCCAATCTA
TCACACTATGTCTGGGAGCCATCACCACCCTGTTTACAGCAATATGTGCCCTCACCCAGAATGACATCAA
GAAAATCGTCGCCTTCTCCACATCCAGCCAGTTAGGCCTTATAATGGTAACGATTGGCATCAACCAACCC
TACCTGGCATTCCTCCATATCTGCACCCACGCCTTTTTCAAGGCCATACTATTCATATGCTCTGGCTCCA
TTATCCACAACCTAAACGACGAACAAGACATTCGAAAAATAGGAGGCCTATCCAAAGCCATACCATTTAC
CACAACAGCCCTTATTATTGGTAGCCTCGCACTAACAGGAATGCCTTTCCTCACAGGATTTTATTCCAAA
GACCTAATCATCGAAGCCGCCAATACGTCATATACCAACGCCTGAGCCCTATTAATAACACTAATTGCCA
CCTCATTCACAGCCATCTACAGCACCCGAATCATTTTCTTCGCACTCCTAGGACAACCCCGATTTCCCAC
CTTGATTATCATCAATGAAAACAACCCCCTTTTAATTAACTCTATCAAACGCTTGCTAATCGGAAGTGTA
TTTGCAGGATTTATTATCTCTAATAGCATCCCCCCAATAACAATTCCCCAGATAACTATACCTTACTACC
TAAAAACAACAGCCCTTATAGTCACAGTCCTAGGCTTTATCCTAGCCCTAGAAGTCAGCAACATAACTCA
AAACCTAAAATTCAATTACCCCTCAAACGCCTTCAAATTCTCCAACATGCTAGGATATTTCCCTGTAATC
ATACATCGCCTAGCTTCTTACACAAACTTAACGATAAGCCAAAAACTAGCATCCTCTCTCCTAGACCTAA
TCTGACTAGAAAACATTTTACCAAAAACCACCTCACTTATCCAGATGAAAGCATCCATCACAGTCACAAA
CCAAAAAGGCCTAATCAAACTATATTTCCTCTCCTTCCTAATCACAATTATCATCAGCATGGCCTTATTT
AATTTCCACGAGTAATTTCTATAATGACCACAACCCCAATTAATAATGACCACCCAGTCACAATAACCAA
CCAAGTCCCATAACTGTATAAAGCCGCAATCCCCATAGCCTCCTCACTAAAAAACCCGGAATCCCCTGTA
TCATAAACAACCCAGTCCCCTAGACCATTAAACTCAAACACAATCTCCACCTCTTTATCTTTCAACACAT
AACAAACTATAAGAAATTCTATCAACAAACCAGTAACAAACGCCCCTAAGACAACTTTATTAGAAACTCA
AATCTCAGGATATTGCTCTGTAGCCATAGCCGTTGTATAACCAAAGACTACCATCATTCCCCCTAAATAA
ATTAAAAAAACTATCAAGCCTAAAAAAGACCCACCAAAATTTAACACAATCCCGCAACCAACCCCACCAC
TCACAATTAACCCTAATCCCCCATAAATAGGTGACGGTTTTGAAGAAAACCCTACAAAACCAATCACAAA
AATAACACTTAAAATAAATACAATGTACAGTATCATTATTCTCACGTGGAATTCAACCACGACCAATGAT
ATGAAAAACCATCGTTGTCATTCAACTACAAGAACATCAATGACCAACATCCGAAAATCCCACCCACTAA
TAAAAATTCTAAACAATGCATTCATTGACCTCCCTGCTCCATCAAACATCTCATCATGATGAAACTTTGG
CTCTCTCCTAGGCATCTGCCTAATCCTGCAAATCCTCACCGGCCTATTCCTAGCAATACACTACACATCC
GACACAACAACAGCATTCTCCTCCGTCGCCCACATCTGCCGGGACGTGAACTATGGATGAATTATTCGAT
ACATACACGCAAACGGAGCTTCAATATTTTTCATCTGCTTATATATACACGTAGGACGAGGCATATACTA
CGGATCATATACCTTTCTAGAAACATGAAACATCGGAGTAATCCTACTATTCGCAGTAATAGCCACAGCA
TTTATAGGATACGTACTGCCATGAGGACAAATATCATTCTGAGGGGCAACAGTCATCACCAACCTTCTCT
CAGCAATCCCATACATTGGTACAAGTCTGGTTGAGTGAATTTGAGGGGGATTCTCAGTAGACAAAGCAAC
CCTCACCCGATTCTTCGCATTTCACTTCATCCTCCCATTCATTATCGCAGCACTTGCAATAGTCCACCTA
TTATTTCTCCACGAAACAGGATCCAACAACCCAACAGGAATCTCATCAGACACAGACAAAATCCCATTCC
ACCCCTATTACACCATTAAAGACATCCTAGGCGCCCTACTATTAATCCTAGCCCTAATACTATTAGTACT
ATTCGCACCCGACCTCCTCGGGGACCCAGACAACTACACCCCAGCAAACCCACTCAACACACCTCCCCAC
ATCAAGCCTGAATGGTACTTCCTATTCGCATACGCAATCTTACGATCAATTCCTAACAAACTAGGAGGGG
TTCTAGCCCTAGTTCTCTCTATCCTAATCCTCATTCTCATGCCCCTGCTACATACATCCAAACAACGAAG
TATGATGTTCCGGCCATTCAGCCAATGCCTATTCTGAATTCTAGTAGCAAACCTGCTAACACTCACATGG
ATTGGAGGACAGCCAGTCGAACACCCATATATTATCATTGGACAACTAGCATCTATCACATACTTCCTCC
TCATCCTAGTGCTAATACCAACGGCCAGCATAATCGAAAATAATCTCTTAAAATGAAGACAAGTCTTTGT
AGTATACTAAATACACTGGTCTTGTAAACCAGAAAAGGAGAACAACCAACCTCCCCAAGACTCAGGGAAG
AGGCTATAGCCCCACTACCAACACCCAAAGCTGAAGTTCTATTTAAACTACTCCCTGAATACTATTAATA
TAGCTCCACAAATGCAAAGAGCCTTCTCAGTATCAAATTCACTAAAACTTGCAACAACTTAACACTGACT
TTACACTCTAGCCTAACATTAGAAATAACTACAACCATCAACACACCTGACCTCATATGTACAACACACA
ACATATGACCCTACTACTCCGAATGGGGGGGGGGACATAACATTAATGTAATAAGGACATAATATGTATA
TAGTACATTATATTATATGCCCCATGCATATAAGCGGGTACACAAACATGCATGATAGTACATAGTACAT
TCAATTATTGATCGTACATAGTGCATTCAAGTCAAATCCGTCCTCGCCAACATGCATATCCCCTCCACTA
GATCACGAGCTTGGTCACCATGCCGCGTGAAACCAGCAACCCTTCAGACAGGGATCCCTCTTCTCGCTCC
GGGCCCATGTCTTGTGGGGGTAGCTATTCAATGAACTTTAACAGGCATCTGGTTCTTTCTTCAGGGCCAT
CTCACCTAAAATCGCCCACTCTTTCCCCTTAAATAAGACATCTCGATGG


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.