Viewing data for Boreogadus saida


Scientific name Boreogadus saida
Common name Arctic cod
Maximum lifespan 7.00 years (Boreogadus saida@AnAge)

Total mtDNA (size: 16745 bases) GC AT G C A T
Base content (bases) 7078 9667 4276 2802 4961 4706
Base content per 1 kb (bases) 423 577 255 167 296 281
Base content (%) 42.3% 57.7%
Total protein-coding genes (size: 11406 bases) GC AT G C A T
Base content (bases) 4744 6662 2997 1747 3621 3041
Base content per 1 kb (bases) 416 584 263 153 317 267
Base content (%) 41.6% 58.4%
D-loop (size: 861 bases) GC AT G C A T
Base content (bases) 301 560 184 117 292 268
Base content per 1 kb (bases) 350 650 214 136 339 311
Base content (%) 35.0% 65.0%
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 709 831 387 322 375 456
Base content per 1 kb (bases) 460 540 251 209 244 296
Base content (%) 46.0% 54.0%
Total rRNA-coding genes (size: 2615 bases) GC AT G C A T
Base content (bases) 1165 1450 613 552 600 850
Base content per 1 kb (bases) 446 554 234 211 229 325
Base content (%) 44.6% 55.4%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 435 516 225 210 212 304
Base content per 1 kb (bases) 457 543 237 221 223 320
Base content (%) 45.7% 54.3%
16S rRNA gene (size: 1664 bases) GC AT G C A T
Base content (bases) 730 934 388 342 388 546
Base content per 1 kb (bases) 439 561 233 206 233 328
Base content (%) 43.9% 56.1%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 266 417 180 86 240 177
Base content per 1 kb (bases) 389 611 264 126 351 259
Base content (%) 38.9% 61.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 54 15 46 53
Base content per 1 kb (bases) 411 589 321 89 274 315
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 658 893 387 271 502 391
Base content per 1 kb (bases) 424 576 250 175 324 252
Base content (%) 42.4% 57.6%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 272 419 163 109 215 204
Base content per 1 kb (bases) 394 606 236 158 311 295
Base content (%) 39.4% 60.6%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 336 450 203 133 248 202
Base content per 1 kb (bases) 427 573 258 169 316 257
Base content (%) 42.7% 57.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 478 663 296 182 388 275
Base content per 1 kb (bases) 419 581 259 160 340 241
Base content (%) 41.9% 58.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 421 554 266 155 316 238
Base content per 1 kb (bases) 432 568 273 159 324 244
Base content (%) 43.2% 56.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 420 625 280 140 333 292
Base content per 1 kb (bases) 402 598 268 134 319 279
Base content (%) 40.2% 59.8%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 144 205 91 53 122 83
Base content per 1 kb (bases) 413 587 261 152 350 238
Base content (%) 41.3% 58.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 560 821 360 200 450 371
Base content per 1 kb (bases) 406 594 261 145 326 269
Base content (%) 40.6% 59.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 92 45 91 69
Base content per 1 kb (bases) 461 539 310 152 306 232
Base content (%) 46.1% 53.9%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 760 1079 476 284 579 500
Base content per 1 kb (bases) 413 587 259 154 315 272
Base content (%) 41.3% 58.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 230 292 154 76 96 196
Base content per 1 kb (bases) 441 559 295 146 184 375
Base content (%) 44.1% 55.9%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 17 (7.52%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 53 (23.45%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 10 17 6 13 3 14 7 0 7 3 4 0 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 7 7 0 4 3 4 0 10 3 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 1 3 1 3 1 1 4 2 1 0 0 7 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 2 0 1 1 0 0 2 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 74 62 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 29 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 45 85 87
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFMIFMFTWAIFLTILPPKVMAHTFPNEPSPQGMTTPKTAPWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 3 (5.45%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 4 1 0 1 0 1 1 1 0 0 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 2 0 1 0 0 0 4 5 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 1 0 0 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 19 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 22 11 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 15 23 16
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 28 (5.43%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 9 20 16 14 22 2 8 7 1 11 8 15 5 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 16 14 16 2 15 11 13 7 12 9 7 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 20 0 13 3 6 1 1 3 7 11 0 0 10 4 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 6 6 9 8 0 2 2 3 2 0 0 0 1 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 118 130 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 135 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 134 167 181
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 10 9 1 9 1 8 8 0 7 5 4 1 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 1 6 9 2 3 1 5 0 4 5 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 4 3 7 0 1 2 7 2 0 0 2 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 5 7 6 3 1 3 0 2 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 58 53 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 63 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 50 88 80
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.43%)
Alanine (Ala, A)
n = 19 (7.28%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 27 (10.34%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 24 (9.2%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 6 (2.3%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 5 12 1 8 0 11 6 1 5 4 7 1 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 2 10 0 2 11 7 2 6 3 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 2 2 6 0 1 2 7 5 2 0 1 0 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 5 3 3 2 0 3 0 2 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 63 54 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 68 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 72 93 82
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 32 (8.44%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 23 (6.07%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 10 22 7 15 5 10 4 2 13 5 13 1 18 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 6 13 8 1 6 10 8 2 7 10 2 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 6 3 8 1 1 2 7 6 0 2 15 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 2 8 2 5 3 1 2 3 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 96 89 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 74 163
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 109 112 132
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 27 (8.33%)
Threonine (Thr, T)
n = 20 (6.17%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 24 (7.41%)
Leucine (Leu, L)
n = 59 (18.21%)
Isoleucine (Ile, I)
n = 18 (5.56%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 7 11 19 11 0 17 5 1 9 3 9 3 14 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 14 13 1 3 8 3 3 6 11 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 7 5 7 2 4 2 9 4 1 1 6 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 2 2 2 6 1 4 1 2 1 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 80 73 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 98 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 88 110 103
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 17 (4.9%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 16 (4.61%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 5 12 15 6 17 4 21 12 2 0 1 6 2 13 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 13 13 14 1 5 4 5 2 10 6 2 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 2 8 5 9 0 2 4 3 3 1 3 8 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 3 2 2 8 0 1 2 0 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 87 107 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 120 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 73 131 116
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 17 (4.9%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 16 (4.61%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 5 12 15 6 17 4 21 12 2 0 1 6 2 13 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 13 13 14 1 5 4 5 2 10 6 2 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 2 8 5 9 0 2 4 3 3 1 3 8 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 3 2 2 8 0 1 2 0 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 87 107 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 120 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 73 131 116
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 40 (8.71%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 15 (3.27%)
Leucine (Leu, L)
n = 100 (21.79%)
Isoleucine (Ile, I)
n = 32 (6.97%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 18 (3.92%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.96%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 7 22 33 15 23 5 20 10 1 6 2 7 0 11 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 0 18 13 9 0 5 5 12 6 15 10 3 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 2 4 4 10 2 5 5 7 7 3 4 8 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 1 1 3 9 1 2 3 5 1 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 135 133 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 127 70 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 98 168 161
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 16 (16.33%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 6 6 5 5 1 6 2 1 0 0 1 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 4 9 2 1 1 2 1 1 1 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 1 4 2 0 1 0 0 0 1 0 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 29 20 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 34 14 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 29 35 29
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.23%)
Alanine (Ala, A)
n = 58 (9.48%)
Serine (Ser, S)
n = 50 (8.17%)
Threonine (Thr, T)
n = 60 (9.8%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 31 (5.07%)
Leucine (Leu, L)
n = 106 (17.32%)
Isoleucine (Ile, I)
n = 41 (6.7%)
Methionine (Met, M)
n = 28 (4.58%)
Proline (Pro, P)
n = 27 (4.41%)
Phenylalanine (Phe, F)
n = 37 (6.05%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 14 (2.29%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 23 (3.76%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 15 18 32 8 25 7 27 14 5 13 7 7 4 22 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 5 21 14 22 1 7 12 8 5 11 7 7 2 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 16 3 17 2 10 2 6 13 7 2 1 7 10 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 2 11 3 14 6 0 3 5 2 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 144 191 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 176 113 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 156 196 204
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 35 (20.23%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 6 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 7 (4.05%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 5 8 1 2 1 17 0 0 7 1 11 6 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 7 5 5 2 6 3 6 10 4 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 3 2 2 1 0 8 0 2 6 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 3 2 0 0 0 1 0 0 2 0 1 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 21 18 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 38 19 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 17 59 61
Total protein-coding genes (size: 11428 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 244 (6.41%)
Alanine (Ala, A)
n = 353 (9.27%)
Serine (Ser, S)
n = 257 (6.75%)
Threonine (Thr, T)
n = 293 (7.7%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 228 (5.99%)
Leucine (Leu, L)
n = 658 (17.29%)
Isoleucine (Ile, I)
n = 256 (6.73%)
Methionine (Met, M)
n = 177 (4.65%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 233 (6.12%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 79 (2.08%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 109 (2.86%)
Glutamine (Gln, Q)
n = 94 (2.47%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 71 (1.87%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
180 76 129 189 86 162 30 165 79 15 79 40 86 23 136 97
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 18 9 109 114 119 11 59 71 75 39 95 73 40 7 81
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
83 117 12 73 36 73 11 26 38 65 43 11 26 70 39 49
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 65 32 43 36 58 13 18 15 28 14 0 1 4 2 109
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1001 957 971 878
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
531 1054 670 1552
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
295 913 1309 1290

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.