Viewing data for Antidorcas marsupialis


Scientific name Antidorcas marsupialis
Common name Springbok
Maximum lifespan 19.80 years (Antidorcas marsupialis@AnAge)

Total mtDNA (size: 16444 bases) GC AT G C A T
Base content (bases) 6148 10296 3996 2152 4738 5558
Base content per 1 kb (bases) 374 626 243 131 288 338
Base content (%) 37.4% 62.6%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4218 7120 2906 1312 3388 3732
Base content per 1 kb (bases) 372 628 256 116 299 329
Base content (%) 37.2% 62.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 551 960 316 235 430 530
Base content per 1 kb (bases) 365 635 209 156 285 351
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 950 1575 512 438 620 955
Base content per 1 kb (bases) 376 624 203 173 246 378
Base content (%) 37.6% 62.4%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 374 580 206 168 226 354
Base content per 1 kb (bases) 392 608 216 176 237 371
Base content (%) 39.2% 60.8%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 576 995 306 270 394 601
Base content per 1 kb (bases) 367 633 195 172 251 383
Base content (%) 36.7% 63.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 249 432 179 70 206 226
Base content per 1 kb (bases) 366 634 263 103 302 332
Base content (%) 36.6% 63.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 64 137 51 13 56 81
Base content per 1 kb (bases) 318 682 254 65 279 403
Base content (%) 31.8% 68.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 598 947 354 244 501 446
Base content per 1 kb (bases) 387 613 229 158 324 289
Base content (%) 38.7% 61.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 246 438 157 89 194 244
Base content per 1 kb (bases) 360 640 230 130 284 357
Base content (%) 36.0% 64.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 319 465 211 108 251 214
Base content per 1 kb (bases) 407 593 269 138 320 273
Base content (%) 40.7% 59.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 471 669 316 155 308 361
Base content per 1 kb (bases) 413 587 277 136 270 317
Base content (%) 41.3% 58.7%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 348 608 235 113 298 310
Base content per 1 kb (bases) 364 636 246 118 312 324
Base content (%) 36.4% 63.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 375 667 286 89 289 378
Base content per 1 kb (bases) 360 640 274 85 277 363
Base content (%) 36.0% 64.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 131 215 94 37 104 111
Base content per 1 kb (bases) 379 621 272 107 301 321
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 503 875 360 143 427 448
Base content per 1 kb (bases) 365 635 261 104 310 325
Base content (%) 36.5% 63.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 100 197 65 35 101 96
Base content per 1 kb (bases) 337 663 219 118 340 323
Base content (%) 33.7% 66.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 660 1161 473 187 549 612
Base content per 1 kb (bases) 362 638 260 103 301 336
Base content (%) 36.2% 63.8%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 174 354 138 36 127 227
Base content per 1 kb (bases) 330 670 261 68 241 430
Base content (%) 33.0% 67.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 5 10 6 6 21 1 11 8 1 1 3 7 0 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 3 6 0 1 3 6 1 6 3 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 0 3 1 5 0 1 4 0 2 0 0 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 66 81 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 38 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 51 107 64
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWVTMILSMFLVLFIIFQLKISKYNFHHNPEPTLTKMPKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 7 (10.61%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 1 1 6 0 1 3 0 0 2 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 2 0 0 4 0 0 0 2 0 0 1 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 26 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 12 35 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 8 29 11 8 24 3 13 6 0 10 5 20 2 27 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 14 10 15 1 11 7 25 4 10 10 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 1 6 9 11 1 0 3 11 8 0 0 12 7 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 2 12 4 8 1 0 2 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 105 141 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 115 209 172
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 15 6 0 14 3 10 6 0 6 0 5 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 1 4 1 0 3 4 1 2 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 12 1 4 5 6 1 1 4 6 5 0 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 2 5 5 6 0 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 55 69 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 47 114 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 9 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 8 11 4 9 1 7 7 0 7 3 5 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 8 4 1 5 9 5 1 5 3 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 5 1 9 1 2 2 5 6 0 0 5 4 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 1 2 2 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 66 63 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 57 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 78 94 84
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 21 13 10 9 27 2 9 5 1 2 8 6 2 7 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 3 6 17 1 3 4 15 2 2 4 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 18 1 2 4 11 2 0 3 5 9 0 1 6 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 2 9 9 0 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 96 113 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 94 76 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 126 172 65
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 9 17 5 7 25 2 16 7 0 2 2 10 1 13 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 4 7 15 2 2 3 7 0 8 6 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 2 5 12 0 3 2 8 4 1 1 6 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 0 3 7 0 0 1 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 79 91 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 89 54 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 67 164 78
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 35 8 9 32 3 5 10 0 3 4 4 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 8 5 0 0 5 8 1 1 5 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 6 7 14 0 0 2 5 3 0 0 5 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 12 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 88 146 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 96 174 67
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 35 8 9 32 3 5 10 0 3 4 4 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 8 5 0 0 5 8 1 1 5 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 6 7 14 0 0 2 5 3 0 0 5 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 12 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 88 146 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 96 174 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 34 (7.42%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 23 (5.02%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 15 34 18 8 42 3 19 9 1 5 2 8 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 4 8 14 1 2 7 6 2 2 10 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 1 7 14 6 1 4 7 9 7 1 3 9 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 1 3 12 0 1 2 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 123 160 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 110 84 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 127 204 110
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 11 2 2 11 1 4 2 0 1 0 4 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 1 4 0 1 0 3 0 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 2 4 3 0 0 1 0 4 0 2 4 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 22 30 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 20 49 24
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 56 (9.24%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 87 (14.36%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 22 (3.63%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 10 (1.65%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
36 25 38 11 13 43 2 17 17 1 7 3 7 1 25 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 5 13 21 0 2 11 15 0 9 10 7 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 26 3 9 12 15 0 1 10 12 10 1 1 15 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 5 6 22 1 1 4 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 132 228 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 158 131 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 183 253 155
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 1 7 0 0 1 0 10 0 1 8 0 5 8 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 0 2 0 13 1 5 7 3 0 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 5 0 2 0 4 0 9 1 2 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 4 1 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 6 51 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 4 43 92
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 240 (6.32%)
Serine (Ser, S)
n = 277 (7.29%)
Threonine (Thr, T)
n = 318 (8.37%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 184 (4.84%)
Leucine (Leu, L)
n = 598 (15.75%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 256 (6.74%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 244 (6.42%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 165 (4.34%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 92 (2.42%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
221 116 225 93 73 267 21 127 83 5 53 32 83 16 134 110
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 7 16 55 68 110 7 40 53 102 19 53 56 82 2 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
71 171 13 53 63 99 6 17 39 74 60 5 17 76 89 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 81 13 32 37 95 3 5 14 44 0 1 0 6 1 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
801 890 1231 877
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 972 747 1619
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
159 955 1675 1010

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.