Viewing data for Bos taurus


Scientific name Bos taurus
Common name Domestic cattle
Maximum lifespan 20.00 years (Bos taurus@AnAge)

Total mtDNA (size: 16338 bases) GC AT G C A T
Base content (bases) 6440 9898 4238 2202 4441 5457
Base content per 1 kb (bases) 394 606 259 135 272 334
Base content (%) 39.4% 60.6%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4527 6808 3136 1391 3145 3663
Base content per 1 kb (bases) 399 601 277 123 277 323
Base content (%) 39.9% 60.1%
D-loop (size: 910 bases) GC AT G C A T
Base content (bases) 347 563 223 124 263 300
Base content per 1 kb (bases) 381 619 245 136 289 330
Base content (%) 38.1% 61.9%
Total tRNA-coding genes (size: 1509 bases) GC AT G C A T
Base content (bases) 545 964 318 227 437 527
Base content per 1 kb (bases) 361 639 211 150 290 349
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 995 1531 546 449 587 944
Base content per 1 kb (bases) 394 606 216 178 232 374
Base content (%) 39.4% 60.6%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 388 567 216 172 216 351
Base content per 1 kb (bases) 406 594 226 180 226 368
Base content (%) 40.6% 59.4%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 607 964 330 277 371 593
Base content per 1 kb (bases) 386 614 210 176 236 377
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 262 419 187 75 190 229
Base content per 1 kb (bases) 385 615 275 110 279 336
Base content (%) 38.5% 61.5%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 64 137 48 16 57 80
Base content per 1 kb (bases) 318 682 239 80 284 398
Base content (%) 31.8% 68.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 644 901 392 252 457 444
Base content per 1 kb (bases) 417 583 254 163 296 287
Base content (%) 41.7% 58.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 264 420 163 101 187 233
Base content per 1 kb (bases) 386 614 238 148 273 341
Base content (%) 38.6% 61.4%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 344 437 227 117 230 207
Base content per 1 kb (bases) 440 560 291 150 294 265
Base content (%) 44.0% 56.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 496 644 343 153 288 356
Base content per 1 kb (bases) 435 565 301 134 253 312
Base content (%) 43.5% 56.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 389 567 266 123 264 303
Base content per 1 kb (bases) 407 593 278 129 276 317
Base content (%) 40.7% 59.3%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 369 673 275 94 295 378
Base content per 1 kb (bases) 354 646 264 90 283 363
Base content (%) 35.4% 64.6%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 147 199 104 43 94 105
Base content per 1 kb (bases) 425 575 301 124 272 303
Base content (%) 42.5% 57.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 540 838 388 152 394 444
Base content per 1 kb (bases) 392 608 282 110 286 322
Base content (%) 39.2% 60.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 73 34 94 96
Base content per 1 kb (bases) 360 640 246 114 316 323
Base content (%) 36.0% 64.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 724 1097 533 191 502 595
Base content per 1 kb (bases) 398 602 293 105 276 327
Base content (%) 39.8% 60.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 195 333 149 46 117 216
Base content per 1 kb (bases) 369 631 282 87 222 409
Base content (%) 36.9% 63.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 27 (11.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 10 6 5 22 3 8 9 0 0 1 10 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 6 5 0 1 2 8 0 3 3 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 0 3 0 6 0 1 6 2 0 0 0 4 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 4 0 0 2 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 67 82 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 63 36 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 57 111 51
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 9 (13.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 13 (19.7%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 2 2 0 2 3 5 3 0 1 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 2 1 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 2 0 0 3 0 0 0 2 0 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 12 34 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 17 (3.31%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 16 27 5 9 25 2 16 6 0 12 8 15 2 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 11 11 19 0 8 8 25 5 9 10 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 1 7 6 13 1 0 4 8 11 3 2 7 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 7 10 8 1 0 2 5 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 100 140 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 158 208 123
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 13 6 0 14 2 12 5 1 1 5 5 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 1 4 1 1 2 3 2 1 4 8 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 3 5 3 8 1 1 4 5 6 0 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 5 5 5 3 3 2 0 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 54 67 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 54 105 47
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 15 (5.79%)
Serine (Ser, S)
n = 18 (6.95%)
Threonine (Thr, T)
n = 24 (9.27%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.18%)
Leucine (Leu, L)
n = 31 (11.97%)
Isoleucine (Ile, I)
n = 14 (5.41%)
Methionine (Met, M)
n = 11 (4.25%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 6 (2.32%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 17 (6.56%)
Lysine (Lys, K)
n = 3 (1.16%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 8 3 6 12 2 6 7 0 4 7 5 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 8 1 0 0 11 6 3 4 3 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 5 5 4 0 1 3 5 6 0 2 1 5 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 0 1 3 2 1 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 64 62 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 98 89 62
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 12 5 13 30 2 9 6 0 1 6 9 2 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 4 9 14 0 1 7 15 2 1 6 15 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 1 4 7 9 0 0 2 4 12 0 1 5 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 1 10 8 2 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 98 109 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 149 169 48
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.42%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 19 5 7 27 4 10 7 0 1 4 7 2 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 9 16 0 2 6 5 1 5 6 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 2 1 9 10 1 1 1 5 6 2 1 6 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 2 1 7 0 0 1 7 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 84 92 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 92 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 90 155 55
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 42 6 6 29 2 7 8 1 1 6 6 1 12 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 9 4 0 0 5 6 3 2 8 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 3 5 5 14 0 1 2 6 2 0 2 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 81 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 100 57 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 94 172 67
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 42 6 6 29 2 7 8 1 1 6 6 1 12 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 9 4 0 0 5 6 3 2 8 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 3 5 5 14 0 1 2 6 2 0 2 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 81 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 100 57 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 94 172 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 15 28 9 16 57 2 8 8 3 4 4 10 0 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 1 6 8 14 0 1 7 8 2 7 5 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 14 2 5 12 10 1 1 9 7 10 3 0 9 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 0 0 4 11 0 1 1 7 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 136 157 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 111 86 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 141 201 95
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 11 2 3 13 0 3 2 0 1 1 6 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 3 4 0 2 0 2 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 3 4 2 0 0 1 2 2 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 24 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 26 51 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 44 (7.26%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 52 (8.58%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 90 (14.85%)
Isoleucine (Ile, I)
n = 64 (10.56%)
Methionine (Met, M)
n = 38 (6.27%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 24 (3.96%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 10 (1.65%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 32 35 9 22 39 4 14 15 2 4 4 5 1 11 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 6 19 19 0 3 12 12 1 4 14 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 26 1 7 13 17 0 3 10 9 15 1 2 11 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 2 9 23 1 2 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 136 225 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 160 132 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 237 238 114
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 4 1 0 2 0 10 0 1 10 2 5 6 12 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 1 1 1 8 2 4 12 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 4 1 1 1 3 1 8 2 3 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 4 4 0 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 45 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 13 39 80
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.72%)
Alanine (Ala, A)
n = 250 (6.58%)
Serine (Ser, S)
n = 277 (7.3%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 191 (5.03%)
Leucine (Leu, L)
n = 595 (15.67%)
Isoleucine (Ile, I)
n = 325 (8.56%)
Methionine (Met, M)
n = 261 (6.87%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 240 (6.32%)
Tyrosine (Tyr, Y)
n = 138 (3.63%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 160 (4.21%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
165 160 216 62 94 283 29 110 79 8 40 49 86 16 107 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 6 16 53 91 104 2 27 62 97 31 42 63 85 3 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
96 154 16 51 65 99 5 12 45 64 74 12 17 60 100 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 78 17 23 46 90 10 7 11 42 3 1 0 7 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
822 904 1214 858
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 973 749 1612
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
214 1168 1623 793

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.