Viewing data for Tarsius syrichta


Scientific name Tarsius syrichta
Common name Philippine tarsier
Maximum lifespan 16.00 years (Tarsius syrichta@AnAge)

Total mtDNA (size: 17004 bases) GC AT G C A T
Base content (bases) 6655 10349 4417 2238 4859 5490
Base content per 1 kb (bases) 391 609 260 132 286 323
Base content (%) 39.1% 60.9%
Total protein-coding genes (size: 11329 bases) GC AT G C A T
Base content (bases) 4454 6875 3097 1357 3375 3500
Base content per 1 kb (bases) 393 607 273 120 298 309
Base content (%) 39.3% 60.7%
D-loop (size: 1534 bases) GC AT G C A T
Base content (bases) 632 902 421 211 402 500
Base content per 1 kb (bases) 412 588 274 138 262 326
Base content (%) 41.2% 58.8%
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 550 960 317 233 428 532
Base content per 1 kb (bases) 364 636 210 154 283 352
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2547 bases) GC AT G C A T
Base content (bases) 981 1566 553 428 636 930
Base content per 1 kb (bases) 385 615 217 168 250 365
Base content (%) 38.5% 61.5%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 378 582 213 165 232 350
Base content per 1 kb (bases) 394 606 222 172 242 365
Base content (%) 39.4% 60.6%
16S rRNA gene (size: 1587 bases) GC AT G C A T
Base content (bases) 603 984 340 263 404 580
Base content per 1 kb (bases) 380 620 214 166 255 365
Base content (%) 38.0% 62.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 256 425 176 80 215 210
Base content per 1 kb (bases) 376 624 258 117 316 308
Base content (%) 37.6% 62.4%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 62 142 50 12 66 76
Base content per 1 kb (bases) 304 696 245 59 324 373
Base content (%) 30.4% 69.6%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 651 891 395 256 487 404
Base content per 1 kb (bases) 422 578 256 166 316 262
Base content (%) 42.2% 57.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 266 418 180 86 191 227
Base content per 1 kb (bases) 389 611 263 126 279 332
Base content (%) 38.9% 61.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 325 459 214 111 243 216
Base content per 1 kb (bases) 415 585 273 142 310 276
Base content (%) 41.5% 58.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 464 676 312 152 343 333
Base content per 1 kb (bases) 407 593 274 133 301 292
Base content (%) 40.7% 59.3%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 388 569 280 108 278 291
Base content per 1 kb (bases) 405 595 293 113 290 304
Base content (%) 40.5% 59.5%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 373 671 271 102 309 362
Base content per 1 kb (bases) 357 643 260 98 296 347
Base content (%) 35.7% 64.3%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 132 214 93 39 111 103
Base content per 1 kb (bases) 382 618 269 113 321 298
Base content (%) 38.2% 61.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 532 846 389 143 405 441
Base content per 1 kb (bases) 386 614 282 104 294 320
Base content (%) 38.6% 61.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 108 189 73 35 102 87
Base content per 1 kb (bases) 364 636 246 118 343 293
Base content (%) 36.4% 63.6%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 717 1098 517 200 544 554
Base content per 1 kb (bases) 395 605 285 110 300 305
Base content (%) 39.5% 60.5%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 197 316 160 37 99 217
Base content per 1 kb (bases) 384 616 312 72 193 423
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 5 11 6 4 17 3 11 7 0 4 0 7 1 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 5 6 1 4 2 3 2 2 3 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 2 6 4 0 1 2 2 0 1 2 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 1 0 4 0 1 0 5 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 62 77 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 35 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 51 98 65
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTTILAMTLTLFILFQLNISKLTYPFNLSLADIKLQTLNSPWELKWTKIYLPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 5 (7.46%)
Threonine (Thr, T)
n = 9 (13.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 16 (23.88%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 5 (7.46%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (5.97%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 1 3 0 7 0 5 4 0 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 0 0 0 2 3 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 1 0 1 3 0 0 1 1 1 0 1 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 2 4 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 24 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 17 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 11 35 19
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 44 (8.58%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 34 (6.63%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.6%)
Leucine (Leu, L)
n = 61 (11.89%)
Isoleucine (Ile, I)
n = 35 (6.82%)
Methionine (Met, M)
n = 32 (6.24%)
Proline (Pro, P)
n = 29 (5.65%)
Phenylalanine (Phe, F)
n = 43 (8.38%)
Tyrosine (Tyr, Y)
n = 18 (3.51%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.73%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 28 13 9 17 5 16 5 1 4 16 16 3 25 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 13 11 19 1 9 12 23 3 13 8 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 6 0 11 8 9 0 0 3 7 11 1 1 7 9 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 3 7 7 7 2 1 1 5 1 0 0 0 1 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 106 129 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 154 182 152
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 6 (2.64%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 12 5 8 14 0 8 4 2 4 3 7 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 5 1 0 0 2 1 5 0 4 7 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 1 4 7 1 1 3 7 3 0 0 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 8 4 5 0 0 2 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 61 67 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 64 98 60
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 12 7 5 12 3 5 7 1 2 4 4 2 12 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 7 2 0 5 8 6 1 3 4 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 1 1 7 9 0 2 2 4 7 1 0 3 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 2 1 3 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 66 66 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 63 55 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 85 95 70
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 13 8 12 23 2 15 6 1 4 6 7 1 13 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 3 9 11 1 5 7 11 2 4 8 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 7 6 7 0 1 2 7 7 0 0 8 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 1 5 6 10 0 0 1 6 1 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 93 110 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 76 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 127 147 90
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.46%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 22 (6.92%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 7 (2.2%)
Leucine (Leu, L)
n = 59 (18.55%)
Isoleucine (Ile, I)
n = 31 (9.75%)
Methionine (Met, M)
n = 21 (6.6%)
Proline (Pro, P)
n = 21 (6.6%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 5 (1.57%)
Histidine (His, H)
n = 5 (1.57%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 7 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 15 18 9 15 27 2 5 4 1 1 2 2 2 9 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 8 16 1 3 4 3 1 3 11 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 8 9 1 2 1 7 5 1 1 6 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 7 0 0 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 97 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 98 137 69
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 32 (9.22%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 11 28 9 7 33 1 15 9 2 1 2 3 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 8 8 1 1 4 7 2 2 9 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 3 6 10 12 0 4 0 4 4 1 0 8 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 1 1 1 14 0 1 1 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 83 135 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 102 62 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 86 165 79
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 32 (9.22%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 11 28 9 7 33 1 15 9 2 1 2 3 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 8 8 1 1 4 7 2 2 9 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 3 6 10 12 0 4 0 4 4 1 0 8 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 1 1 1 14 0 1 1 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 83 135 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 102 62 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 86 165 79
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 47 (10.26%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 89 (19.43%)
Isoleucine (Ile, I)
n = 47 (10.26%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 22 29 17 15 36 2 16 8 0 3 4 4 1 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 4 16 9 1 2 5 10 0 4 9 8 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 22 0 5 11 9 1 3 8 9 9 4 3 10 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 1 0 3 12 0 2 0 8 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 121 172 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 125 82 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 143 187 110
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 5 (5.1%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 9 4 4 9 2 5 2 0 1 1 3 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 4 1 0 3 1 0 0 0 0 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 1 1 5 0 0 1 2 3 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 26 28 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 26 41 26
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.64%)
Alanine (Ala, A)
n = 41 (6.79%)
Serine (Ser, S)
n = 52 (8.61%)
Threonine (Thr, T)
n = 64 (10.6%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 16 (2.65%)
Leucine (Leu, L)
n = 96 (15.89%)
Isoleucine (Ile, I)
n = 54 (8.94%)
Methionine (Met, M)
n = 37 (6.13%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 43 (7.12%)
Tyrosine (Tyr, Y)
n = 19 (3.15%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 27 (4.47%)
Glutamine (Gln, Q)
n = 15 (2.48%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 22 32 18 23 36 2 15 15 0 4 5 4 3 28 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 5 10 17 14 0 5 7 13 3 2 13 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 27 3 11 17 13 0 5 6 7 12 1 2 9 18 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 2 4 6 16 4 2 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 145 213 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 172 119 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 200 222 158
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.88%)
Alanine (Ala, A)
n = 6 (3.53%)
Serine (Ser, S)
n = 16 (9.41%)
Threonine (Thr, T)
n = 6 (3.53%)
Cysteine (Cys, C)
n = 1 (0.59%)
Valine (Val, V)
n = 22 (12.94%)
Leucine (Leu, L)
n = 24 (14.12%)
Isoleucine (Ile, I)
n = 9 (5.29%)
Methionine (Met, M)
n = 12 (7.06%)
Proline (Pro, P)
n = 3 (1.76%)
Phenylalanine (Phe, F)
n = 15 (8.82%)
Tyrosine (Tyr, Y)
n = 7 (4.12%)
Tryptophan (Trp, W)
n = 6 (3.53%)
Aspartic acid (Asp, D)
n = 4 (2.35%)
Glutamic acid (Glu, E)
n = 7 (4.12%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.18%)
Arginine (Arg, R)
n = 3 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 5 2 0 0 1 12 0 0 10 0 5 7 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 0 1 1 8 3 5 11 2 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 5 0 2 0 8 1 6 1 4 9 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 2 3 1 0 2 2 0 0 1 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 9 39 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 22 20 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 6 40 78
Total protein-coding genes (size: 11385 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.67%)
Alanine (Ala, A)
n = 253 (6.67%)
Serine (Ser, S)
n = 286 (7.54%)
Threonine (Thr, T)
n = 323 (8.52%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 631 (16.64%)
Isoleucine (Ile, I)
n = 328 (8.65%)
Methionine (Met, M)
n = 244 (6.43%)
Proline (Pro, P)
n = 189 (4.98%)
Phenylalanine (Phe, F)
n = 240 (6.33%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 97 (2.56%)
Asparagine (Asn, N)
n = 143 (3.77%)
Glutamine (Gln, Q)
n = 81 (2.14%)
Histidine (His, H)
n = 97 (2.56%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
200 128 204 109 106 240 25 131 73 8 39 43 62 23 139 101
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 9 17 66 89 91 7 47 56 87 25 42 77 66 4 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
105 141 12 51 82 91 3 27 32 66 63 14 20 64 79 44
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
53 84 13 34 35 85 8 9 14 41 4 1 0 6 3 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
801 915 1191 887
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
474 992 718 1610
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
209 1080 1494 1011

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.