Viewing data for Acipenser ruthenus


Scientific name Acipenser ruthenus
Common name Sterlet
Maximum lifespan 46.10 years (Acipenser ruthenus@AnAge)

Total mtDNA (size: 16790 bases) GC AT G C A T
Base content (bases) 7596 9194 4869 2727 4114 5080
Base content per 1 kb (bases) 452 548 290 162 245 303
Base content (%) 45.2% 54.8%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5254 6158 3541 1713 2859 3299
Base content per 1 kb (bases) 460 540 310 150 251 289
Base content (%) 46.0% 54.0%
D-loop (size: 1069 bases) GC AT G C A T
Base content (bases) 377 692 237 140 334 358
Base content per 1 kb (bases) 353 647 222 131 312 335
Base content (%) 35.3% 64.7%
Total tRNA-coding genes (size: 1558 bases) GC AT G C A T
Base content (bases) 691 867 380 311 389 478
Base content per 1 kb (bases) 444 556 244 200 250 307
Base content (%) 44.4% 55.6%
Total rRNA-coding genes (size: 2667 bases) GC AT G C A T
Base content (bases) 1225 1442 682 543 519 923
Base content per 1 kb (bases) 459 541 256 204 195 346
Base content (%) 45.9% 54.1%
12S rRNA gene (size: 961 bases) GC AT G C A T
Base content (bases) 470 491 263 207 182 309
Base content per 1 kb (bases) 489 511 274 215 189 322
Base content (%) 48.9% 51.1%
16S rRNA gene (size: 1706 bases) GC AT G C A T
Base content (bases) 755 951 419 336 337 614
Base content per 1 kb (bases) 443 557 246 197 198 360
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 317 367 226 91 183 184
Base content per 1 kb (bases) 463 537 330 133 268 269
Base content (%) 46.3% 53.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 71 97 50 21 43 54
Base content per 1 kb (bases) 423 577 298 125 256 321
Base content (%) 42.3% 57.7%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 732 822 432 300 440 382
Base content per 1 kb (bases) 471 529 278 193 283 246
Base content (%) 47.1% 52.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 308 383 189 119 172 211
Base content per 1 kb (bases) 446 554 274 172 249 305
Base content (%) 44.6% 55.4%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 376 409 240 136 202 207
Base content per 1 kb (bases) 479 521 306 173 257 264
Base content (%) 47.9% 52.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 525 616 352 173 309 307
Base content per 1 kb (bases) 460 540 309 152 271 269
Base content (%) 46.0% 54.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 454 521 309 145 248 273
Base content per 1 kb (bases) 466 534 317 149 254 280
Base content (%) 46.6% 53.4%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 465 580 337 128 237 343
Base content per 1 kb (bases) 445 555 322 122 227 328
Base content (%) 44.5% 55.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 163 186 106 57 100 86
Base content per 1 kb (bases) 467 533 304 163 287 246
Base content (%) 46.7% 53.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 631 750 423 208 350 400
Base content per 1 kb (bases) 457 543 306 151 253 290
Base content (%) 45.7% 54.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 105 41 76 75
Base content per 1 kb (bases) 492 508 354 138 256 253
Base content (%) 49.2% 50.8%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 829 1013 589 240 447 566
Base content per 1 kb (bases) 450 550 320 130 243 307
Base content (%) 45.0% 55.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 243 279 187 56 58 221
Base content per 1 kb (bases) 466 534 358 107 111 423
Base content (%) 46.6% 53.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 6 5 16 23 4 7 9 0 6 1 6 1 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 5 1 3 4 3 1 2 10 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 3 0 1 1 0 1 4 1 2 1 1 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 2 0 0 3 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 84 67 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 34 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 84 83 45
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFMILVFSWLIFLIVLPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 1 0 2 1 2 1 0 1 1 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 1 5 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 1 0 0 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 16 18 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 16 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 18 22 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 11 11 6 25 6 9 5 3 6 11 19 8 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 0 1 8 27 11 2 7 17 17 6 5 12 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 5 10 8 2 0 5 8 11 2 5 6 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 5 10 7 1 2 2 3 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 111 125 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 184 163 113
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 6 4 5 10 5 4 8 0 2 4 10 4 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 3 6 6 1 0 3 5 1 2 5 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 2 7 5 0 1 2 5 5 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 2 0 12 4 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 62 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 73 94 42
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 7 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 7 7 5 12 4 2 9 0 3 8 7 0 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 10 11 1 1 7 8 4 2 6 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 2 4 3 0 0 3 4 8 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 3 2 2 0 0 3 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 70 53 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 102 99 45
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 8 6 19 19 5 8 6 3 2 8 13 2 16 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 16 8 0 2 9 13 4 2 9 8 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 4 10 6 1 0 1 5 8 0 4 7 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 1 10 8 1 0 1 6 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 99 95 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 79 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 158 133 63
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 20 (6.17%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (4.94%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 25 (7.72%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 18 9 5 11 28 5 10 6 0 3 3 8 2 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 5 14 12 2 2 9 4 3 2 8 12 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 7 0 3 8 4 2 1 1 4 10 1 2 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 1 1 3 7 0 0 1 7 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 92 81 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 94 61 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 123 131 45
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 50 (14.41%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 20 9 10 28 8 7 12 2 1 3 4 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 19 12 1 2 7 5 2 1 10 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 21 1 1 6 9 0 3 4 4 5 2 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 2 10 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 96 131 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 121 153 53
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 50 (14.41%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 20 9 10 28 8 7 12 2 1 3 4 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 19 12 1 2 7 5 2 1 10 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 21 1 1 6 9 0 3 4 4 5 2 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 2 10 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 96 131 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 121 153 53
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 41 (8.93%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 21 (4.58%)
Leucine (Leu, L)
n = 87 (18.95%)
Isoleucine (Ile, I)
n = 39 (8.5%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 18 14 14 36 11 11 12 0 6 5 8 2 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 1 23 15 2 2 10 10 4 3 10 13 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 1 0 15 7 0 1 5 7 7 1 1 1 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 2 0 3 7 3 0 2 9 0 0 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 134 135 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 130 75 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 159 190 75
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 4 7 9 0 3 3 0 0 0 2 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 7 3 0 0 2 4 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 1 1 5 0 1 0 2 0 1 0 1 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 21 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 43 38 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 52 (8.48%)
Serine (Ser, S)
n = 46 (7.5%)
Threonine (Thr, T)
n = 61 (9.95%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 22 (3.59%)
Leucine (Leu, L)
n = 94 (15.33%)
Isoleucine (Ile, I)
n = 56 (9.14%)
Methionine (Met, M)
n = 29 (4.73%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 40 (6.53%)
Tyrosine (Tyr, Y)
n = 11 (1.79%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 29 (4.73%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 28 18 9 23 41 9 12 21 1 3 6 11 2 16 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 2 4 4 34 12 2 2 11 14 4 1 14 13 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 26 0 4 14 12 1 1 14 5 6 3 0 2 27 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 2 10 21 1 1 1 6 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
128 159 212 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 174 124 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 256 230 91
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 6 1 0 0 10 0 0 11 0 3 15 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 1 3 5 7 0 1 16 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 5 1 1 3 2 0 10 0 5 15 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 1 0 1 1 0 0 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 16 16 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 23 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
72 5 19 78
Total protein-coding genes (size: 11434 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 243 (6.38%)
Alanine (Ala, A)
n = 338 (8.88%)
Serine (Ser, S)
n = 234 (6.14%)
Threonine (Thr, T)
n = 311 (8.17%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 227 (5.96%)
Leucine (Leu, L)
n = 631 (16.57%)
Isoleucine (Ile, I)
n = 279 (7.33%)
Methionine (Met, M)
n = 175 (4.6%)
Proline (Pro, P)
n = 213 (5.59%)
Phenylalanine (Phe, F)
n = 220 (5.78%)
Tyrosine (Tyr, Y)
n = 118 (3.1%)
Tryptophan (Trp, W)
n = 119 (3.13%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 100 (2.63%)
Asparagine (Asn, N)
n = 129 (3.39%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 80 (2.1%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
148 131 111 84 121 245 59 92 95 9 45 53 91 38 108 112
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
64 10 18 44 170 107 17 28 82 87 46 28 93 81 11 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
139 128 9 29 85 58 10 10 42 54 64 18 30 29 100 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 83 17 17 58 72 8 5 15 48 7 0 0 4 3 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
983 1004 1026 796
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
517 1044 716 1532
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
346 1366 1403 694

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.