Viewing data for Cercocebus torquatus


Scientific name Cercocebus torquatus
Common name Red-capped mangabey
Maximum lifespan 46.00 years (Cercocebus torquatus@AnAge)

Total mtDNA (size: 16542 bases) GC AT G C A T
Base content (bases) 6851 9691 4829 2022 4312 5379
Base content per 1 kb (bases) 414 586 292 122 261 325
Base content (%) 41.4% 58.6%
Total protein-coding genes (size: 11361 bases) GC AT G C A T
Base content (bases) 4698 6663 3484 1214 3048 3615
Base content per 1 kb (bases) 414 586 307 107 268 318
Base content (%) 41.4% 58.6%
D-loop (size: 1066 bases) GC AT G C A T
Base content (bases) 479 587 340 139 264 323
Base content per 1 kb (bases) 449 551 319 130 248 303
Base content (%) 44.9% 55.1%
Total tRNA-coding genes (size: 1501 bases) GC AT G C A T
Base content (bases) 570 931 352 218 402 529
Base content per 1 kb (bases) 380 620 235 145 268 352
Base content (%) 38.0% 62.0%
Total rRNA-coding genes (size: 2516 bases) GC AT G C A T
Base content (bases) 1054 1462 615 439 580 882
Base content per 1 kb (bases) 419 581 244 174 231 351
Base content (%) 41.9% 58.1%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 419 534 243 176 212 322
Base content per 1 kb (bases) 440 560 255 185 222 338
Base content (%) 44.0% 56.0%
16S rRNA gene (size: 1563 bases) GC AT G C A T
Base content (bases) 635 928 372 263 368 560
Base content per 1 kb (bases) 406 594 238 168 235 358
Base content (%) 40.6% 59.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 270 411 209 61 184 227
Base content per 1 kb (bases) 396 604 307 90 270 333
Base content (%) 39.6% 60.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 75 126 66 9 45 81
Base content per 1 kb (bases) 373 627 328 45 224 403
Base content (%) 37.3% 62.7%
COX1 (size: 1569 bases) GC AT G C A T
Base content (bases) 668 901 426 242 465 436
Base content per 1 kb (bases) 426 574 272 154 296 278
Base content (%) 42.6% 57.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 285 399 190 95 183 216
Base content per 1 kb (bases) 417 583 278 139 268 316
Base content (%) 41.7% 58.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 347 437 239 108 221 216
Base content per 1 kb (bases) 443 557 305 138 282 276
Base content (%) 44.3% 55.7%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 481 660 360 121 308 352
Base content per 1 kb (bases) 422 578 316 106 270 309
Base content (%) 42.2% 57.8%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 416 539 317 99 243 296
Base content per 1 kb (bases) 436 564 332 104 254 310
Base content (%) 43.6% 56.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 417 625 337 80 267 358
Base content per 1 kb (bases) 400 600 323 77 256 344
Base content (%) 40.0% 60.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 131 215 99 32 101 114
Base content per 1 kb (bases) 379 621 286 92 292 329
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 558 820 439 119 367 453
Base content per 1 kb (bases) 405 595 319 86 266 329
Base content (%) 40.5% 59.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 123 174 88 35 87 87
Base content per 1 kb (bases) 414 586 296 118 293 293
Base content (%) 41.4% 58.6%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 734 1072 549 185 492 580
Base content per 1 kb (bases) 406 594 304 102 272 321
Base content (%) 40.6% 59.4%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 207 318 175 32 100 218
Base content per 1 kb (bases) 394 606 333 61 190 415
Base content (%) 39.4% 60.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 32 (14.16%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 12 6 6 26 5 6 10 0 2 1 6 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 5 0 1 3 4 0 2 4 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 2 3 4 3 0 0 2 2 2 0 0 4 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 0 0 4 2 0 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 73 88 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 69 42 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 67 97 52
ATP8 (size: 201 bases)
Amino acid sequence: VPQLDTSTWFTTITTTLPTLYLIMQLKLLNMNYYRPPLTKNLNLQTHNNHQQSKWTKIYLPYSQLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 11 (16.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 3 (4.55%)
Methionine (Met, M)
n = 2 (3.03%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 1 (1.52%)
Tyrosine (Tyr, Y)
n = 5 (7.58%)
Tryptophan (Trp, W)
n = 2 (3.03%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 6 (9.09%)
Glutamine (Gln, Q)
n = 7 (10.61%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 4 (6.06%)
Arginine (Arg, R)
n = 1 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 2 3 4 1 2 7 0 0 0 0 1 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 0 0 0 0 0 0 0 1 4 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 1 0 2 0 0 0 3 2 0 0 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 1 0 4 0 0 0 1 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 25 26 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 26 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 22 29 12
COX1 (size: 1569 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.0%)
Alanine (Ala, A)
n = 38 (7.28%)
Serine (Ser, S)
n = 33 (6.32%)
Threonine (Thr, T)
n = 32 (6.13%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 29 (5.56%)
Leucine (Leu, L)
n = 63 (12.07%)
Isoleucine (Ile, I)
n = 46 (8.81%)
Methionine (Met, M)
n = 34 (6.51%)
Proline (Pro, P)
n = 31 (5.94%)
Phenylalanine (Phe, F)
n = 41 (7.85%)
Tyrosine (Tyr, Y)
n = 22 (4.21%)
Tryptophan (Trp, W)
n = 16 (3.07%)
Aspartic acid (Asp, D)
n = 14 (2.68%)
Glutamic acid (Glu, E)
n = 11 (2.11%)
Asparagine (Asn, N)
n = 19 (3.64%)
Glutamine (Gln, Q)
n = 7 (1.34%)
Histidine (His, H)
n = 18 (3.45%)
Lysine (Lys, K)
n = 11 (2.11%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 21 29 7 8 36 3 6 5 2 10 7 10 2 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 20 12 0 9 16 17 5 9 15 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 1 9 6 13 0 2 3 10 12 0 3 5 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 2 9 5 9 2 4 1 4 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 119 147 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 129 103 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 178 186 134
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 9 4 3 14 4 5 6 1 5 4 4 1 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 5 4 0 1 4 5 1 0 6 8 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 2 4 4 0 0 2 5 4 0 2 6 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 4 5 4 0 1 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 60 67 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 56 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 69 93 54
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 7 4 8 14 1 9 7 1 4 4 3 1 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 9 3 0 2 11 6 1 2 5 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 4 3 10 1 0 4 4 10 4 0 3 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 0 0 3 3 0 2 0 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 67 64 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 104 96 50
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 18 (4.75%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 37 (9.76%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 11 (2.9%)
Leucine (Leu, L)
n = 65 (17.15%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 23 (6.07%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 10 (2.64%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 16 8 18 27 2 10 9 0 3 0 8 0 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 1 4 13 0 3 12 6 1 4 6 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 4 9 10 0 1 3 1 13 0 0 7 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 1 2 5 5 10 0 0 3 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 106 125 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 102 73 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 152 154 66
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 35 (11.04%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 6 (1.89%)
Leucine (Leu, L)
n = 60 (18.93%)
Isoleucine (Ile, I)
n = 23 (7.26%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 15 (4.73%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 16 10 15 31 1 3 6 0 3 1 2 0 4 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 12 10 1 1 6 5 0 2 14 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 1 6 11 1 0 3 2 9 0 0 3 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 3 7 0 1 0 6 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 93 102 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 56 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 122 138 51
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 13 (3.76%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 30 (8.67%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 28 5 16 28 6 8 10 0 1 1 1 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 6 2 0 2 5 8 0 1 10 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 23 1 4 12 7 0 1 4 5 5 0 0 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 9 1 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 97 149 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 105 62 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 135 147 55
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 13 (3.76%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 30 (8.67%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 28 5 16 28 6 8 10 0 1 1 1 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 6 2 0 2 5 8 0 1 10 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 23 1 4 12 7 0 1 4 5 5 0 0 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 9 1 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 97 149 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 105 62 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 135 147 55
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 24 (5.24%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 50 (10.92%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 85 (18.56%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 40 (8.73%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 25 (5.46%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 30 32 13 16 46 1 9 9 1 2 1 3 0 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 3 12 9 0 2 10 4 0 6 14 5 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 24 0 9 8 9 0 2 8 5 9 1 0 5 20 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 0 3 12 0 1 2 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 136 180 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 125 89 196
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 178 184 84
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 3 (3.06%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 5 10 4 5 7 4 1 2 0 1 1 2 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 4 3 1 0 1 3 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 0 3 5 0 0 0 2 1 0 0 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 28 33 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 18 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 36 36 19
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 45 (7.49%)
Serine (Ser, S)
n = 48 (7.99%)
Threonine (Thr, T)
n = 63 (10.48%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 12 (2.0%)
Leucine (Leu, L)
n = 96 (15.97%)
Isoleucine (Ile, I)
n = 52 (8.65%)
Methionine (Met, M)
n = 38 (6.32%)
Proline (Pro, P)
n = 29 (4.83%)
Phenylalanine (Phe, F)
n = 38 (6.32%)
Tyrosine (Tyr, Y)
n = 21 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 11 (1.83%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 36 (5.99%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 11 (1.83%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 25 36 16 25 43 8 4 18 2 1 4 7 0 15 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 11 22 12 0 3 13 8 2 6 8 15 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 25 2 4 16 17 0 2 9 10 11 1 0 15 21 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 1 4 7 20 1 1 3 3 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 160 221 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 174 130 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 215 229 138
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (17.82%)
Alanine (Ala, A)
n = 8 (4.6%)
Serine (Ser, S)
n = 9 (5.17%)
Threonine (Thr, T)
n = 6 (3.45%)
Cysteine (Cys, C)
n = 2 (1.15%)
Valine (Val, V)
n = 29 (16.67%)
Leucine (Leu, L)
n = 23 (13.22%)
Isoleucine (Ile, I)
n = 10 (5.75%)
Methionine (Met, M)
n = 11 (6.32%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 8 (4.6%)
Tyrosine (Tyr, Y)
n = 9 (5.17%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 4 (2.3%)
Glutamic acid (Glu, E)
n = 8 (4.6%)
Asparagine (Asn, N)
n = 4 (2.3%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 3 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 5 2 0 0 1 13 0 0 14 0 8 7 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 4 0 2 2 17 0 3 11 3 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 4 0 0 2 3 0 9 0 4 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 4 0 0 1 1 0 0 2 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 9 36 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 23 26 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 0 38 87
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 233 (6.13%)
Serine (Ser, S)
n = 267 (7.03%)
Threonine (Thr, T)
n = 377 (9.92%)
Cysteine (Cys, C)
n = 21 (0.55%)
Valine (Val, V)
n = 137 (3.61%)
Leucine (Leu, L)
n = 630 (16.58%)
Isoleucine (Ile, I)
n = 333 (8.76%)
Methionine (Met, M)
n = 244 (6.42%)
Proline (Pro, P)
n = 204 (5.37%)
Phenylalanine (Phe, F)
n = 215 (5.66%)
Tyrosine (Tyr, Y)
n = 139 (3.66%)
Tryptophan (Trp, W)
n = 101 (2.66%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 82 (2.16%)
Asparagine (Asn, N)
n = 178 (4.68%)
Glutamine (Gln, Q)
n = 99 (2.61%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
156 177 209 84 126 287 38 83 92 7 46 25 54 12 84 131
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
35 7 14 45 106 78 4 41 81 71 21 38 90 74 2 72
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
139 156 10 45 74 94 4 11 39 59 80 10 12 60 118 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 68 14 27 36 86 7 13 15 31 4 0 1 5 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
729 1002 1276 794
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
450 1031 761 1559
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
182 1318 1479 822

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.