Viewing data for Callorhinchus capensis


Scientific name Callorhinchus capensis
Common name Cape elephantfish
Maximum lifespan 12.00 years (Callorhinchus capensis@AnAge)

Total mtDNA (size: 16760 bases) GC AT G C A T
Base content (bases) 5707 11053 3545 2162 5631 5422
Base content per 1 kb (bases) 341 659 212 129 336 324
Base content (%) 34.1% 65.9%
Total protein-coding genes (size: 11374 bases) GC AT G C A T
Base content (bases) 3771 7603 2475 1296 4066 3537
Base content per 1 kb (bases) 332 668 218 114 357 311
Base content (%) 33.2% 66.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 510 1025 290 220 466 559
Base content per 1 kb (bases) 332 668 189 143 304 364
Base content (%) 33.2% 66.8%
Total rRNA-coding genes (size: 2605 bases) GC AT G C A T
Base content (bases) 999 1606 539 460 678 928
Base content per 1 kb (bases) 383 617 207 177 260 356
Base content (%) 38.3% 61.7%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 402 550 222 180 241 309
Base content per 1 kb (bases) 422 578 233 189 253 325
Base content (%) 42.2% 57.8%
16S rRNA gene (size: 1653 bases) GC AT G C A T
Base content (bases) 597 1056 317 280 437 619
Base content per 1 kb (bases) 361 639 192 169 264 374
Base content (%) 36.1% 63.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 218 466 155 63 250 216
Base content per 1 kb (bases) 319 681 227 92 365 316
Base content (%) 31.9% 68.1%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 40 125 34 6 60 65
Base content per 1 kb (bases) 242 758 206 36 364 394
Base content (%) 24.2% 75.8%
COX1 (size: 1560 bases) GC AT G C A T
Base content (bases) 566 994 334 232 568 426
Base content per 1 kb (bases) 363 637 214 149 364 273
Base content (%) 36.3% 63.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 247 444 149 98 228 216
Base content per 1 kb (bases) 357 643 216 142 330 313
Base content (%) 35.7% 64.3%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 283 503 166 117 281 222
Base content per 1 kb (bases) 360 640 211 149 358 282
Base content (%) 36.0% 64.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 390 750 251 139 430 320
Base content per 1 kb (bases) 342 658 220 122 377 281
Base content (%) 34.2% 65.8%
ND1 (size: 960 bases) GC AT G C A T
Base content (bases) 334 626 223 111 348 278
Base content per 1 kb (bases) 348 652 232 116 363 290
Base content (%) 34.8% 65.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 330 712 239 91 359 353
Base content per 1 kb (bases) 317 683 229 87 345 339
Base content (%) 31.7% 68.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 114 235 72 42 146 89
Base content per 1 kb (bases) 327 673 206 120 418 255
Base content (%) 32.7% 67.3%
ND4 (size: 1376 bases) GC AT G C A T
Base content (bases) 454 922 308 146 483 439
Base content per 1 kb (bases) 330 670 224 106 351 319
Base content (%) 33.0% 67.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 100 197 66 34 111 86
Base content per 1 kb (bases) 337 663 222 114 374 290
Base content (%) 33.7% 66.3%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 533 1291 360 173 686 605
Base content per 1 kb (bases) 292 708 197 95 376 332
Base content (%) 29.2% 70.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 165 357 119 46 124 233
Base content per 1 kb (bases) 316 684 228 88 238 446
Base content (%) 31.6% 68.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.64%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 13 (5.73%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 11 13 3 19 0 24 8 0 5 1 6 0 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 12 2 3 0 3 1 2 0 6 2 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 2 1 3 0 4 1 2 2 0 0 12 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 0 3 0 1 0 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 65 72 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 61 37 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 29 107 90
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPHPWFMIFLFTWIIFLTILPNKIYKHTYTNKPSINITLPKLNNWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 1 (1.85%)
Threonine (Thr, T)
n = 5 (9.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 8 (14.81%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.96%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 1 1 0 1 0 4 1 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 1 0 0 0 0 2 0 0 0 7 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 12 26 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 13 17 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 9 22 23
COX1 (size: 1560 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.06%)
Alanine (Ala, A)
n = 41 (7.9%)
Serine (Ser, S)
n = 31 (5.97%)
Threonine (Thr, T)
n = 38 (7.32%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.55%)
Leucine (Leu, L)
n = 66 (12.72%)
Isoleucine (Ile, I)
n = 42 (8.09%)
Methionine (Met, M)
n = 28 (5.39%)
Proline (Pro, P)
n = 28 (5.39%)
Phenylalanine (Phe, F)
n = 40 (7.71%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.89%)
Glutamic acid (Glu, E)
n = 9 (1.73%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 21 (4.05%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 16 27 20 6 13 0 27 7 1 14 7 12 1 25 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 20 10 11 0 19 9 19 0 15 5 8 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 18 2 20 2 5 0 2 2 11 6 1 0 12 6 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 0 13 2 9 1 2 0 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 104 141 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 134 98 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 96 187 229
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 14 (6.11%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 8 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 11 (4.8%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 10 (4.37%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 4 8 5 3 6 1 14 9 1 8 2 7 1 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 3 4 5 0 4 1 3 1 5 4 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 8 1 6 2 5 0 1 2 5 3 1 0 5 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 6 5 4 0 3 1 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 54 60 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 64 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 43 92 86
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 19 (7.28%)
Serine (Ser, S)
n = 17 (6.51%)
Threonine (Thr, T)
n = 21 (8.05%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 17 (6.51%)
Methionine (Met, M)
n = 10 (3.83%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 24 (9.2%)
Tyrosine (Tyr, Y)
n = 10 (3.83%)
Tryptophan (Trp, W)
n = 13 (4.98%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 5 8 9 1 13 0 10 9 0 7 0 8 1 15 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 8 3 8 0 9 4 5 1 6 1 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 10 1 6 1 6 0 3 1 7 3 0 1 3 1 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 0 3 1 2 0 0 0 5 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 63 58 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 54 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 39 110 106
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 35 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 24 (6.33%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 12 12 12 6 14 2 21 7 1 8 2 11 0 25 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 8 7 7 1 16 2 6 0 7 7 5 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 1 8 7 6 0 0 1 10 2 0 1 14 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 6 1 9 0 0 2 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 83 111 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 89 79 165
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 79 130 160
ND1 (size: 960 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.7%)
Alanine (Ala, A)
n = 25 (7.84%)
Serine (Ser, S)
n = 26 (8.15%)
Threonine (Thr, T)
n = 19 (5.96%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.39%)
Leucine (Leu, L)
n = 65 (20.38%)
Isoleucine (Ile, I)
n = 27 (8.46%)
Methionine (Met, M)
n = 17 (5.33%)
Proline (Pro, P)
n = 23 (7.21%)
Phenylalanine (Phe, F)
n = 14 (4.39%)
Tyrosine (Tyr, Y)
n = 13 (4.08%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 12 (3.76%)
Asparagine (Asn, N)
n = 13 (4.08%)
Glutamine (Gln, Q)
n = 5 (1.57%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 8 15 19 6 18 0 22 5 0 6 3 5 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 13 3 9 0 5 6 2 2 10 5 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 8 0 8 5 10 0 3 0 11 2 0 0 10 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 0 3 1 6 1 2 0 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 82 86 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 90 58 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 51 134 129
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 25 (7.23%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 24 17 7 15 1 29 10 2 1 1 3 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 11 6 7 0 6 0 9 0 6 4 9 0 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 18 0 9 4 7 0 2 3 6 1 0 0 14 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 1 1 0 10 1 2 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 135 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 104 60 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 55 158 128
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 25 (7.23%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 24 17 7 15 1 29 10 2 1 1 3 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 11 6 7 0 6 0 9 0 6 4 9 0 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 18 0 9 4 7 0 2 3 6 1 0 0 14 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 1 1 0 10 1 2 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 135 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 104 60 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 55 158 128
ND4 (size: 1376 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.38%)
Alanine (Ala, A)
n = 27 (5.91%)
Serine (Ser, S)
n = 40 (8.75%)
Threonine (Thr, T)
n = 40 (8.75%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 12 (2.63%)
Leucine (Leu, L)
n = 83 (18.16%)
Isoleucine (Ile, I)
n = 54 (11.82%)
Methionine (Met, M)
n = 30 (6.56%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 18 (3.94%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 18 (3.94%)
Aspartic acid (Asp, D)
n = 4 (0.88%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 18 (3.94%)
Glutamine (Gln, Q)
n = 10 (2.19%)
Histidine (His, H)
n = 12 (2.63%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 16 28 15 5 22 2 38 10 0 2 3 7 0 11 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 2 9 8 9 1 6 3 9 2 8 5 10 0 19
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 9 11 12 0 5 3 7 6 1 1 12 6 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 2 2 2 10 1 2 2 7 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 100 161 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 122 77 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 86 200 160
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 4 8 2 3 0 11 2 0 1 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 0 3 5 0 4 0 0 0 1 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 0 2 4 0 5 0 2 0 0 0 5 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 0 0 0 0 0 2 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 23 31 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 27 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 16 38 43
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.61%)
Alanine (Ala, A)
n = 36 (5.93%)
Serine (Ser, S)
n = 47 (7.74%)
Threonine (Thr, T)
n = 44 (7.25%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 13 (2.14%)
Leucine (Leu, L)
n = 93 (15.32%)
Isoleucine (Ile, I)
n = 76 (12.52%)
Methionine (Met, M)
n = 39 (6.43%)
Proline (Pro, P)
n = 26 (4.28%)
Phenylalanine (Phe, F)
n = 37 (6.1%)
Tyrosine (Tyr, Y)
n = 19 (3.13%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.81%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 42 (6.92%)
Glutamine (Gln, Q)
n = 15 (2.47%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 29 (4.78%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
51 25 37 25 9 15 0 44 15 0 7 1 5 0 29 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 3 18 11 7 0 12 4 12 0 11 8 6 1 26
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 19 4 12 1 5 6 11 8 1 0 33 9 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 1 9 2 29 0 3 2 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 111 241 156
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 142 141 258
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 107 223 272
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 20 (11.56%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 7 (4.05%)
Methionine (Met, M)
n = 13 (7.51%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 5 (2.89%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 1 8 5 0 1 0 20 0 0 10 0 8 2 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 8 0 2 1 6 0 10 5 2 0 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 0 2 0 4 0 9 0 2 5 5 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 4 0 0 0 0 0 2 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 17 33 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 28 25 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 1 66 85
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 251 (6.61%)
Serine (Ser, S)
n = 267 (7.03%)
Threonine (Thr, T)
n = 290 (7.64%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 168 (4.43%)
Leucine (Leu, L)
n = 642 (16.91%)
Isoleucine (Ile, I)
n = 361 (9.51%)
Methionine (Met, M)
n = 209 (5.51%)
Proline (Pro, P)
n = 201 (5.3%)
Phenylalanine (Phe, F)
n = 234 (6.16%)
Tyrosine (Tyr, Y)
n = 118 (3.11%)
Tryptophan (Trp, W)
n = 115 (3.03%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 175 (4.61%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 102 (2.69%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
247 114 184 155 50 147 7 275 85 6 70 20 73 5 162 72
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
25 23 7 114 58 76 3 92 31 79 11 85 43 68 5 126
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
44 115 5 98 40 73 2 35 19 85 33 6 8 134 41 74
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
28 89 6 49 15 88 4 15 10 42 3 0 1 8 0 109
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
791 823 1182 1001
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
483 955 745 1614
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
97 625 1511 1564

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.