Viewing data for Ziphius cavirostris


Scientific name Ziphius cavirostris
Common name Cuvier's beaked whale
Maximum lifespan 62.00 years (Ziphius cavirostris@AnAge)

Total mtDNA (size: 16349 bases) GC AT G C A T
Base content (bases) 6478 9871 4350 2128 4502 5369
Base content per 1 kb (bases) 396 604 266 130 275 328
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11347 bases) GC AT G C A T
Base content (bases) 4542 6805 3240 1302 3182 3623
Base content per 1 kb (bases) 400 600 286 115 280 319
Base content (%) 40.0% 60.0%
D-loop (size: 878 bases) GC AT G C A T
Base content (bases) 359 519 225 134 259 260
Base content per 1 kb (bases) 409 591 256 153 295 296
Base content (%) 40.9% 59.1%
Total tRNA-coding genes (size: 1513 bases) GC AT G C A T
Base content (bases) 553 960 326 227 425 535
Base content per 1 kb (bases) 365 635 215 150 281 354
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2552 bases) GC AT G C A T
Base content (bases) 999 1553 545 454 622 931
Base content per 1 kb (bases) 391 609 214 178 244 365
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 407 565 227 180 220 345
Base content per 1 kb (bases) 419 581 234 185 226 355
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1580 bases) GC AT G C A T
Base content (bases) 592 988 318 274 402 586
Base content per 1 kb (bases) 375 625 201 173 254 371
Base content (%) 37.5% 62.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 263 418 196 67 202 216
Base content per 1 kb (bases) 386 614 288 98 297 317
Base content (%) 38.6% 61.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 72 129 60 12 50 79
Base content per 1 kb (bases) 358 642 299 60 249 393
Base content (%) 35.8% 64.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 632 919 380 252 471 448
Base content per 1 kb (bases) 407 593 245 162 304 289
Base content (%) 40.7% 59.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 265 419 176 89 186 233
Base content per 1 kb (bases) 387 613 257 130 272 341
Base content (%) 38.7% 61.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 337 448 230 107 227 221
Base content per 1 kb (bases) 429 571 293 136 289 282
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 490 650 342 148 313 337
Base content per 1 kb (bases) 430 570 300 130 275 296
Base content (%) 43.0% 57.0%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 387 570 274 113 267 303
Base content per 1 kb (bases) 404 596 286 118 279 317
Base content (%) 40.4% 59.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 400 642 314 86 271 371
Base content per 1 kb (bases) 384 616 301 83 260 356
Base content (%) 38.4% 61.6%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 133 214 97 36 100 114
Base content per 1 kb (bases) 383 617 280 104 288 329
Base content (%) 38.3% 61.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 549 829 406 143 387 442
Base content per 1 kb (bases) 398 602 295 104 281 321
Base content (%) 39.8% 60.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 84 42 89 82
Base content per 1 kb (bases) 424 576 283 141 300 276
Base content (%) 42.4% 57.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 722 1099 540 182 528 571
Base content per 1 kb (bases) 396 604 297 100 290 314
Base content (%) 39.6% 60.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 156 33 110 229
Base content per 1 kb (bases) 358 642 295 63 208 434
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 13 (5.75%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 10 4 11 19 2 7 7 1 3 2 8 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 5 2 0 1 5 3 0 4 4 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 1 3 5 3 1 0 3 1 1 0 0 6 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 6 0 1 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 66 84 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 65 39 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 93 61
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLLVISSMLLALFTLFQLKISKHLYYPNPKMMTTKSEKQQTPWNTTWTKIYLPLSQSQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 7 (10.61%)
Threonine (Thr, T)
n = 9 (13.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 11 (16.67%)
Isoleucine (Ile, I)
n = 3 (4.55%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 2 (3.03%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 6 (9.09%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 3 3 3 3 0 1 4 2 1 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 1 0 1 6 0 0 0 2 1 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 21 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 22 21 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 17 34 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 39 (7.56%)
Serine (Ser, S)
n = 34 (6.59%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.36%)
Leucine (Leu, L)
n = 58 (11.24%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 31 (6.01%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 18 (3.49%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 27 6 4 30 2 16 6 0 12 7 15 4 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 9 13 17 0 11 10 19 8 14 5 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 3 9 5 17 0 0 3 11 7 2 0 9 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 9 6 9 0 1 1 6 0 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 103 138 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 137 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 140 216 137
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 14 4 3 20 1 4 5 1 3 4 7 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 4 2 1 0 2 1 4 1 6 3 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 3 7 5 0 1 3 5 4 0 0 3 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 6 5 4 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 60 69 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 61 103 55
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 8 5 9 16 1 3 7 0 6 3 7 0 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 7 4 0 2 7 11 0 4 5 3 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 4 3 9 1 1 3 4 6 0 0 3 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 1 2 3 0 0 2 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 72 60 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 54 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 94 106 58
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 29 (7.65%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 64 (16.89%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 29 11 6 15 29 4 10 7 0 2 7 5 1 9 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 10 17 0 3 10 10 1 4 8 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 1 5 5 7 0 2 2 10 6 1 0 6 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 4 7 10 0 1 1 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 104 106 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 93 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 145 154 70
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 18 (5.66%)
Threonine (Thr, T)
n = 26 (8.18%)
Cysteine (Cys, C)
n = 3 (0.94%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 59 (18.55%)
Isoleucine (Ile, I)
n = 22 (6.92%)
Methionine (Met, M)
n = 22 (6.92%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 9 (2.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 20 6 12 25 2 13 6 0 2 2 8 1 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 12 14 0 2 5 6 0 3 10 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 17 0 4 6 7 0 0 1 5 5 0 1 9 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 3 7 0 0 2 7 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 86 90 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 94 55 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 94 158 59
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 34 5 15 28 2 10 10 1 0 4 5 0 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 1 11 5 1 2 5 7 0 3 6 10 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 3 5 10 8 0 0 1 4 5 1 1 4 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 1 0 11 1 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 89 145 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 111 58 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 114 168 54
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 50 (14.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 34 5 15 28 2 10 10 1 0 4 5 0 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 1 11 5 1 2 5 7 0 3 6 10 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 3 5 10 8 0 0 1 4 5 1 1 4 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 1 0 11 1 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 89 145 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 111 58 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 114 168 54
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 31 17 17 48 2 15 10 1 2 3 6 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 9 11 12 0 1 8 9 0 7 8 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 24 0 8 10 7 1 3 7 6 9 0 0 5 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 2 0 3 10 1 1 2 7 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 142 152 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 119 84 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 145 206 94
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 5 1 5 10 3 3 2 0 2 2 4 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 6 4 0 2 1 1 0 0 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 0 1 5 1 0 0 1 3 0 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 26 26 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 34 39 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 40 (6.6%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 60 (9.9%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 106 (17.49%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 29 (4.79%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 22 (3.63%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 30 25 20 25 45 2 13 20 2 3 1 9 0 19 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 2 10 17 12 1 6 6 13 2 10 11 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 27 0 12 9 13 1 0 11 6 14 1 1 12 23 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 3 6 18 4 1 4 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 163 211 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 163 133 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 214 227 147
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 29 (16.57%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 13 (7.43%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 1 1 0 0 1 13 0 1 14 0 3 12 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 5 0 1 0 13 0 5 9 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 5 0 2 0 4 1 8 1 1 4 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 5 2 1 3 0 0 0 0 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 7 41 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 23 30 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 3 39 91
Total protein-coding genes (size: 11412 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 249 (6.55%)
Serine (Ser, S)
n = 266 (7.0%)
Threonine (Thr, T)
n = 339 (8.92%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 186 (4.89%)
Leucine (Leu, L)
n = 635 (16.71%)
Isoleucine (Ile, I)
n = 305 (8.02%)
Methionine (Met, M)
n = 228 (6.0%)
Proline (Pro, P)
n = 197 (5.18%)
Phenylalanine (Phe, F)
n = 239 (6.29%)
Tyrosine (Tyr, Y)
n = 127 (3.34%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 161 (4.24%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 99 (2.6%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
143 162 195 85 120 288 22 112 86 10 50 35 79 22 96 143
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 9 16 55 99 93 2 45 59 90 21 62 66 66 3 72
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
74 183 10 61 67 85 4 11 38 67 60 6 8 62 99 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 81 13 28 37 90 7 5 16 43 1 2 0 6 1 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 972 1181 840
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 1002 746 1593
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
163 1158 1598 883

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.