Viewing data for Accipiter gentilis


Scientific name Accipiter gentilis
Common name Northern goshawk
Maximum lifespan 22.00 years (Accipiter gentilis@AnAge)

Total mtDNA (size: 18266 bases) GC AT G C A T
Base content (bases) 8057 10208 5737 2320 4396 5812
Base content per 1 kb (bases) 441 559 314 127 241 318
Base content (%) 44.1% 55.9%
Total protein-coding genes (size: 11375 bases) GC AT G C A T
Base content (bases) 5222 6152 3922 1300 2679 3473
Base content per 1 kb (bases) 459 541 345 114 236 305
Base content (%) 45.9% 54.1%
D-loop (size: 1977 bases) GC AT G C A T
Base content (bases) 755 1222 504 251 623 599
Base content per 1 kb (bases) 382 618 255 127 315 303
Base content (%) 38.2% 61.8%
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 654 886 395 259 377 509
Base content per 1 kb (bases) 425 575 256 168 245 331
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2566 bases) GC AT G C A T
Base content (bases) 1159 1407 676 483 548 859
Base content per 1 kb (bases) 452 548 263 188 214 335
Base content (%) 45.2% 54.8%
12S rRNA gene (size: 971 bases) GC AT G C A T
Base content (bases) 463 508 274 189 202 306
Base content per 1 kb (bases) 477 523 282 195 208 315
Base content (%) 47.7% 52.3%
16S rRNA gene (size: 1595 bases) GC AT G C A T
Base content (bases) 696 899 402 294 346 553
Base content per 1 kb (bases) 436 564 252 184 217 347
Base content (%) 43.6% 56.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 307 377 247 60 162 215
Base content per 1 kb (bases) 449 551 361 88 237 314
Base content (%) 44.9% 55.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 65 7 43 53
Base content per 1 kb (bases) 429 571 387 42 256 315
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 716 835 477 239 395 440
Base content per 1 kb (bases) 462 538 308 154 255 284
Base content (%) 46.2% 53.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 219 92 150 223
Base content per 1 kb (bases) 455 545 320 135 219 326
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 369 415 257 112 197 218
Base content per 1 kb (bases) 471 529 328 143 251 278
Base content (%) 47.1% 52.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 535 608 403 132 286 322
Base content per 1 kb (bases) 468 532 353 115 250 282
Base content (%) 46.8% 53.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 433 542 319 114 264 278
Base content per 1 kb (bases) 444 556 327 117 271 285
Base content (%) 44.4% 55.6%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 469 572 370 99 235 337
Base content per 1 kb (bases) 451 549 355 95 226 324
Base content (%) 45.1% 54.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 146 205 111 35 96 109
Base content per 1 kb (bases) 416 584 316 100 274 311
Base content (%) 41.6% 58.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 633 745 496 137 319 426
Base content per 1 kb (bases) 459 541 360 99 231 309
Base content (%) 45.9% 54.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 98 37 77 85
Base content per 1 kb (bases) 455 545 330 125 259 286
Base content (%) 45.5% 54.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 853 964 660 193 393 571
Base content per 1 kb (bases) 469 530 363 106 216 314
Base content (%) 46.9% 53.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 248 271 203 45 66 205
Base content per 1 kb (bases) 478 522 391 87 127 395
Base content (%) 47.8% 52.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 29 (12.78%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 15 9 3 14 38 2 4 9 0 1 5 2 0 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 7 4 0 1 3 4 0 1 7 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 1 4 4 0 1 3 2 1 0 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 0 1 3 0 2 3 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 92 72 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 68 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 87 108 29
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFPIMLLSWLTFTLIIQPKTLSFTSTNAPSNKLTSPTPTSSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 7 (12.73%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 1 1 2 2 0 2 2 0 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 1 4 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 1 4 2 0 0 0 0 0 0 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 16 21 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 10 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 23 22 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 27 (5.23%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 26 3 16 33 2 6 9 1 5 12 18 1 7 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 9 26 10 0 9 15 23 0 5 8 16 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 0 2 9 13 0 0 3 5 12 0 2 2 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 2 13 9 0 0 2 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 122 135 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 94 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 215 211 81
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 28 (12.33%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 12 0 6 22 0 0 6 1 4 5 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 7 6 0 0 4 3 1 2 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 1 2 6 6 0 0 2 1 7 0 0 1 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 2 5 7 3 0 0 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 62 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 96 99 27
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 8 4 7 20 0 0 8 0 2 4 8 0 6 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 7 12 0 4 6 9 0 2 7 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 1 9 4 0 0 5 3 7 3 0 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 0 1 4 2 0 0 1 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 72 60 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 117 104 36
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 30 (7.89%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 10 (2.63%)
Leucine (Leu, L)
n = 68 (17.89%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 6 (1.58%)
Proline (Pro, P)
n = 27 (7.11%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 21 5 8 15 38 2 5 8 0 2 0 8 0 4 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 4 15 7 1 2 11 11 0 2 11 12 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 10 0 4 12 6 0 1 1 2 12 0 0 5 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 0 6 9 1 0 3 4 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 118 102 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 106 79 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 179 141 52
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.01%)
Alanine (Ala, A)
n = 28 (8.64%)
Serine (Ser, S)
n = 28 (8.64%)
Threonine (Thr, T)
n = 24 (7.41%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.7%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 25 (7.72%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 15 (4.63%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 11 9 17 27 4 9 6 1 0 2 10 0 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 6 11 10 1 0 5 7 1 5 9 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 6 9 7 1 2 3 7 8 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 0 2 2 6 1 0 4 4 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 99 85 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 98 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 122 134 57
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 58 (16.76%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 23 (6.65%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 17 (4.91%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 14 4 18 36 4 3 6 2 0 2 7 0 1 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 14 9 0 1 4 7 0 5 8 6 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 1 0 13 11 1 0 3 2 4 3 0 2 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 1 14 0 0 1 2 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 104 126 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 129 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 137 153 41
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 58 (16.76%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 23 (6.65%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 17 (4.91%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 14 4 18 36 4 3 6 2 0 2 7 0 1 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 14 9 0 1 4 7 0 5 8 6 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 1 0 13 11 1 0 3 2 4 3 0 2 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 1 14 0 0 1 2 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 104 126 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 129 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 137 153 41
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 55 (12.01%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 109 (23.8%)
Isoleucine (Ile, I)
n = 35 (7.64%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 19 (4.15%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 27 20 10 29 53 3 14 12 1 0 2 7 0 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 5 12 13 0 1 8 6 2 3 12 13 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 21 0 4 9 12 0 0 10 4 8 2 0 1 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 6 3 0 3 9 0 1 4 6 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 166 146 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 138 78 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 192 202 50
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 5 0 3 12 0 5 2 0 0 2 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 1 7 2 0 0 1 3 0 0 0 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 3 3 1 2 1 1 1 0 0 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 28 23 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 32 17 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 38 45 14
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 49 (8.1%)
Threonine (Thr, T)
n = 79 (13.06%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 9 (1.49%)
Leucine (Leu, L)
n = 112 (18.51%)
Isoleucine (Ile, I)
n = 54 (8.93%)
Methionine (Met, M)
n = 24 (3.97%)
Proline (Pro, P)
n = 34 (5.62%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 21 (3.47%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 42 20 3 38 60 3 7 18 0 1 5 2 1 6 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 6 29 14 0 3 8 20 2 4 10 18 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 31 2 3 19 15 0 0 12 0 14 0 0 2 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 13 0 1 5 21 0 1 5 2 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 177 211 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 199 107 230
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 284 253 54
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.91%)
Valine (Val, V)
n = 37 (21.51%)
Leucine (Leu, L)
n = 25 (14.53%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 3 0 1 1 5 0 0 14 2 6 15 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 5 0 2 0 7 2 6 1 3 19 4 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 1 2 1 3 0 5 2 5 15 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 4 0 0 1 0 0 1 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 14 18 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 25 18 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
72 6 30 65
Total protein-coding genes (size: 11393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 285 (7.51%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 384 (10.12%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 681 (17.94%)
Isoleucine (Ile, I)
n = 284 (7.48%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 228 (6.01%)
Phenylalanine (Phe, F)
n = 219 (5.77%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 124 (3.27%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 115 (3.03%)
Lysine (Lys, K)
n = 82 (2.16%)
Arginine (Arg, R)
n = 69 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
90 194 137 48 175 355 21 64 90 6 29 41 75 17 44 175
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 9 20 44 141 96 4 27 67 99 25 35 82 103 8 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
166 153 4 30 99 89 4 9 44 33 78 14 17 25 99 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
88 84 8 16 46 79 3 4 26 35 4 0 1 8 2 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 1107 1092 778
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
476 1119 692 1509
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
165 1541 1559 531

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.