Viewing data for Cacajao calvus


Scientific name Cacajao calvus
Common name Red uakari
Maximum lifespan 35.80 years (Cacajao calvus@AnAge)

Total mtDNA (size: 16702 bases) GC AT G C A T
Base content (bases) 6468 10234 4305 2163 4779 5455
Base content per 1 kb (bases) 387 613 258 130 286 327
Base content (%) 38.7% 61.3%
Total protein-coding genes (size: 11346 bases) GC AT G C A T
Base content (bases) 4401 6945 3070 1331 3330 3615
Base content per 1 kb (bases) 388 612 271 117 293 319
Base content (%) 38.8% 61.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1497 bases) GC AT G C A T
Base content (bases) 532 965 310 222 430 535
Base content per 1 kb (bases) 355 645 207 148 287 357
Base content (%) 35.5% 64.5%
Total rRNA-coding genes (size: 2500 bases) GC AT G C A T
Base content (bases) 1018 1482 592 426 609 873
Base content per 1 kb (bases) 407 593 237 170 244 349
Base content (%) 40.7% 59.3%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 398 553 227 171 223 330
Base content per 1 kb (bases) 419 581 239 180 234 347
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1549 bases) GC AT G C A T
Base content (bases) 620 929 365 255 386 543
Base content per 1 kb (bases) 400 600 236 165 249 351
Base content (%) 40.0% 60.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 255 426 190 65 205 221
Base content per 1 kb (bases) 374 626 279 95 301 325
Base content (%) 37.4% 62.6%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 55 152 39 16 71 81
Base content per 1 kb (bases) 266 734 188 77 343 391
Base content (%) 26.6% 73.4%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 630 927 387 243 485 442
Base content per 1 kb (bases) 405 595 249 156 311 284
Base content (%) 40.5% 59.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 273 415 177 96 198 217
Base content per 1 kb (bases) 397 603 257 140 288 315
Base content (%) 39.7% 60.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 331 453 213 118 234 219
Base content per 1 kb (bases) 422 578 272 151 298 279
Base content (%) 42.2% 57.8%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 472 665 331 141 338 327
Base content per 1 kb (bases) 415 585 291 124 297 288
Base content (%) 41.5% 58.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 389 567 281 108 266 301
Base content per 1 kb (bases) 407 593 294 113 278 315
Base content (%) 40.7% 59.3%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 358 681 279 79 310 371
Base content per 1 kb (bases) 345 655 269 76 298 357
Base content (%) 34.5% 65.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 134 212 92 42 105 107
Base content per 1 kb (bases) 387 613 266 121 303 309
Base content (%) 38.7% 61.3%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 517 858 371 146 404 454
Base content per 1 kb (bases) 376 624 270 106 294 330
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 97 200 67 30 104 96
Base content per 1 kb (bases) 327 673 226 101 350 323
Base content (%) 32.7% 67.3%
ND5 (size: 1794 bases) GC AT G C A T
Base content (bases) 710 1084 511 199 508 576
Base content per 1 kb (bases) 396 604 285 111 283 321
Base content (%) 39.6% 60.4%
ND6 (size: 543 bases) GC AT G C A T
Base content (bases) 199 344 147 52 121 223
Base content per 1 kb (bases) 366 634 271 96 223 411
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 17 (7.52%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 8 9 6 4 29 4 7 8 1 2 1 5 1 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 6 7 0 1 2 6 0 4 6 2 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 4 5 3 1 1 3 2 2 0 0 4 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 0 4 0 0 0 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 73 84 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 62 38 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 55 99 62
ATP8 (size: 207 bases)
Amino acid sequence: MPQLEISSWPAVILSMVVALFYSIQMKMLNFTFYTSPLSNNIKNYKYKTTWQMKWTKIYLPLSTSPLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.94%)
Serine (Ser, S)
n = 9 (13.24%)
Threonine (Thr, T)
n = 6 (8.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.41%)
Leucine (Leu, L)
n = 8 (11.76%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 5 (7.35%)
Proline (Pro, P)
n = 5 (7.35%)
Phenylalanine (Phe, F)
n = 3 (4.41%)
Tyrosine (Tyr, Y)
n = 5 (7.35%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.47%)
Asparagine (Asn, N)
n = 4 (5.88%)
Glutamine (Gln, Q)
n = 3 (4.41%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 1 0 2 0 3 3 0 1 0 1 1 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 3 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 0 2 1 5 0 0 1 5 0 0 2 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 0 0 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 11 27 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 20 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 7 34 22
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 37 (7.14%)
Serine (Ser, S)
n = 33 (6.37%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.37%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 29 (5.6%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 9 25 12 9 25 3 9 5 2 6 9 16 2 28 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 11 12 13 1 8 14 20 4 9 7 12 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 6 8 15 0 2 2 10 11 1 3 5 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 0 5 10 11 0 2 2 3 1 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 112 145 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 102 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 141 195 158
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 14 (6.14%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.39%)
Leucine (Leu, L)
n = 29 (12.72%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 11 (4.82%)
Tyrosine (Tyr, Y)
n = 13 (5.7%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 7 (3.07%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 6 10 4 5 12 1 6 6 2 1 2 7 0 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 7 6 0 1 4 2 1 4 2 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 2 3 9 0 0 4 4 9 1 1 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 3 5 5 3 1 2 1 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 55 64 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 66 91 59
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 10 6 2 12 2 5 9 1 6 3 5 0 11 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 9 6 1 2 8 10 0 3 3 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 6 3 5 1 0 4 7 7 0 0 3 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 4 1 1 0 1 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 66 55 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 71 59 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 76 105 71
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.08%)
Alanine (Ala, A)
n = 23 (6.08%)
Serine (Ser, S)
n = 30 (7.94%)
Threonine (Thr, T)
n = 30 (7.94%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 12 (3.17%)
Leucine (Leu, L)
n = 59 (15.61%)
Isoleucine (Ile, I)
n = 39 (10.32%)
Methionine (Met, M)
n = 14 (3.7%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 28 (7.41%)
Tyrosine (Tyr, Y)
n = 14 (3.7%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 13 (3.44%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 15 (3.97%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 11 (2.91%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 16 12 13 4 28 4 9 5 3 3 3 5 1 15 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 6 10 7 0 2 14 7 0 3 9 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 4 11 8 1 1 5 3 11 2 1 5 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 6 7 10 0 0 2 4 1 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 100 114 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 75 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 129 138 95
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.47%)
Alanine (Ala, A)
n = 32 (10.09%)
Serine (Ser, S)
n = 25 (7.89%)
Threonine (Thr, T)
n = 27 (8.52%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 9 (2.84%)
Leucine (Leu, L)
n = 60 (18.93%)
Isoleucine (Ile, I)
n = 25 (7.89%)
Methionine (Met, M)
n = 21 (6.62%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 14 (4.42%)
Tyrosine (Tyr, Y)
n = 14 (4.42%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 9 18 8 9 32 3 8 6 0 2 2 5 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 8 10 13 1 2 7 2 0 3 9 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 2 4 14 2 2 1 6 8 2 0 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 1 1 5 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 90 94 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 102 56 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 89 150 68
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 38 (11.01%)
Methionine (Met, M)
n = 31 (8.99%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 30 8 10 28 2 14 10 0 4 1 4 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 7 5 6 0 2 5 5 0 5 7 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 24 0 6 8 10 1 2 3 6 5 1 0 10 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 0 11 0 1 2 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 88 142 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 100 63 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 166 84
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 38 (11.01%)
Methionine (Met, M)
n = 31 (8.99%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 30 8 10 28 2 14 10 0 4 1 4 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 7 5 6 0 2 5 5 0 5 7 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 24 0 6 8 10 1 2 3 6 5 1 0 10 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 0 11 0 1 2 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 88 142 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 100 63 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 166 84
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.16%)
Alanine (Ala, A)
n = 28 (6.13%)
Serine (Ser, S)
n = 35 (7.66%)
Threonine (Thr, T)
n = 43 (9.41%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 93 (20.35%)
Isoleucine (Ile, I)
n = 35 (7.66%)
Methionine (Met, M)
n = 39 (8.53%)
Proline (Pro, P)
n = 29 (6.35%)
Phenylalanine (Phe, F)
n = 18 (3.94%)
Tyrosine (Tyr, Y)
n = 18 (3.94%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.03%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 12 34 15 6 45 4 21 6 2 4 2 6 1 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 3 12 13 0 3 7 8 1 7 10 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 3 8 14 2 4 4 6 12 4 2 9 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 1 2 0 11 1 1 1 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 126 160 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 127 80 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 118 214 103
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 5 (5.1%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 9 1 1 14 0 9 2 0 2 0 3 0 5 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 1 5 0 0 3 1 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 4 3 0 0 0 3 2 0 0 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 25 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 21 19 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 23 52 23
ND5 (size: 1794 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.86%)
Alanine (Ala, A)
n = 39 (6.53%)
Serine (Ser, S)
n = 52 (8.71%)
Threonine (Thr, T)
n = 60 (10.05%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 20 (3.35%)
Leucine (Leu, L)
n = 89 (14.91%)
Isoleucine (Ile, I)
n = 55 (9.21%)
Methionine (Met, M)
n = 41 (6.87%)
Proline (Pro, P)
n = 29 (4.86%)
Phenylalanine (Phe, F)
n = 38 (6.37%)
Tyrosine (Tyr, Y)
n = 22 (3.69%)
Tryptophan (Trp, W)
n = 12 (2.01%)
Aspartic acid (Asp, D)
n = 8 (1.34%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 28 (4.69%)
Glutamine (Gln, Q)
n = 17 (2.85%)
Histidine (His, H)
n = 12 (2.01%)
Lysine (Lys, K)
n = 23 (3.85%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 21 33 19 20 39 1 10 16 1 4 3 11 2 14 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 1 12 12 14 1 2 16 10 1 5 12 12 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 1 5 13 19 2 4 9 6 16 3 0 14 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 4 2 6 21 2 2 2 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 145 220 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 167 123 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 199 233 140
ND6 (size: 543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (13.89%)
Alanine (Ala, A)
n = 11 (6.11%)
Serine (Ser, S)
n = 10 (5.56%)
Threonine (Thr, T)
n = 11 (6.11%)
Cysteine (Cys, C)
n = 2 (1.11%)
Valine (Val, V)
n = 22 (12.22%)
Leucine (Leu, L)
n = 22 (12.22%)
Isoleucine (Ile, I)
n = 12 (6.67%)
Methionine (Met, M)
n = 13 (7.22%)
Proline (Pro, P)
n = 6 (3.33%)
Phenylalanine (Phe, F)
n = 11 (6.11%)
Tyrosine (Tyr, Y)
n = 10 (5.56%)
Tryptophan (Trp, W)
n = 5 (2.78%)
Aspartic acid (Asp, D)
n = 4 (2.22%)
Glutamic acid (Glu, E)
n = 8 (4.44%)
Asparagine (Asn, N)
n = 2 (1.11%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.56%)
Lysine (Lys, K)
n = 3 (1.67%)
Arginine (Arg, R)
n = 2 (1.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 4 2 0 1 0 13 0 0 9 0 10 3 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 0 6 1 3 1 14 2 2 7 5 0 0 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 2 3 0 1 2 4 0 7 3 1 6 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 3 4 0 1 2 1 0 0 1 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 12 45 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 34 29 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 6 47 89
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.5%)
Alanine (Ala, A)
n = 259 (6.82%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 328 (8.64%)
Cysteine (Cys, C)
n = 19 (0.5%)
Valine (Val, V)
n = 165 (4.34%)
Leucine (Leu, L)
n = 611 (16.09%)
Isoleucine (Ile, I)
n = 327 (8.61%)
Methionine (Met, M)
n = 245 (6.45%)
Proline (Pro, P)
n = 210 (5.53%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 155 (4.08%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 89 (2.34%)
Asparagine (Asn, N)
n = 157 (4.13%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 60 (1.58%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
218 109 200 98 73 281 26 118 78 13 47 27 80 11 127 94
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 10 9 65 92 97 5 37 82 75 15 54 66 88 2 77
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 159 5 43 70 106 12 20 36 67 88 15 15 67 90 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
59 75 14 30 35 88 7 11 12 33 4 0 1 3 3 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
787 933 1209 870
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
450 1028 752 1569
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
193 1029 1571 1006

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.