Viewing data for Gyrinophilus porphyriticus


Scientific name Gyrinophilus porphyriticus
Common name Northern spring salamander
Maximum lifespan 18.50 years (Gyrinophilus porphyriticus@AnAge)

Total mtDNA (size: 16778 bases) GC AT G C A T
Base content (bases) 6306 10471 4038 2268 4687 5784
Base content per 1 kb (bases) 376 624 241 135 279 345
Base content (%) 37.6% 62.4%
Total protein-coding genes (size: 11322 bases) GC AT G C A T
Base content (bases) 4243 7078 2851 1392 3343 3735
Base content per 1 kb (bases) 375 625 252 123 295 330
Base content (%) 37.5% 62.5%
D-loop (size: 767 bases) GC AT G C A T
Base content (bases) 276 491 162 114 240 251
Base content per 1 kb (bases) 360 640 211 149 313 327
Base content (%) 36.0% 64.0%
Total tRNA-coding genes (size: 1526 bases) GC AT G C A T
Base content (bases) 588 938 346 242 407 531
Base content per 1 kb (bases) 385 615 227 159 267 348
Base content (%) 38.5% 61.5%
Total rRNA-coding genes (size: 2457 bases) GC AT G C A T
Base content (bases) 977 1480 545 432 545 935
Base content per 1 kb (bases) 398 602 222 176 222 381
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 910 bases) GC AT G C A T
Base content (bases) 376 534 209 167 196 338
Base content per 1 kb (bases) 413 587 230 184 215 371
Base content (%) 41.3% 58.7%
16S rRNA gene (size: 1547 bases) GC AT G C A T
Base content (bases) 601 946 336 265 349 597
Base content per 1 kb (bases) 388 612 217 171 226 386
Base content (%) 38.8% 61.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 251 433 180 71 218 215
Base content per 1 kb (bases) 367 633 263 104 319 314
Base content (%) 36.7% 63.3%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 47 118 38 9 49 69
Base content per 1 kb (bases) 285 715 230 55 297 418
Base content (%) 28.5% 71.5%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 619 926 366 253 491 435
Base content per 1 kb (bases) 401 599 237 164 318 282
Base content (%) 40.1% 59.9%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 261 427 168 93 191 236
Base content per 1 kb (bases) 379 621 244 135 278 343
Base content (%) 37.9% 62.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 318 466 201 117 239 227
Base content per 1 kb (bases) 406 594 256 149 305 290
Base content (%) 40.6% 59.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 416 725 269 147 361 364
Base content per 1 kb (bases) 365 635 236 129 316 319
Base content (%) 36.5% 63.5%
ND1 (size: 960 bases) GC AT G C A T
Base content (bases) 350 610 235 115 294 316
Base content per 1 kb (bases) 365 635 245 120 306 329
Base content (%) 36.5% 63.5%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 370 671 273 97 289 382
Base content per 1 kb (bases) 355 645 262 93 278 367
Base content (%) 35.5% 64.5%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 136 212 86 50 112 100
Base content per 1 kb (bases) 391 609 247 144 322 287
Base content (%) 39.1% 60.9%
ND4 (size: 1372 bases) GC AT G C A T
Base content (bases) 513 859 360 153 407 452
Base content per 1 kb (bases) 374 626 262 112 297 329
Base content (%) 37.4% 62.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 180 86 30 88 92
Base content per 1 kb (bases) 391 606 290 101 296 310
Base content (%) 39.1% 60.6%
ND5 (size: 1796 bases) GC AT G C A T
Base content (bases) 644 1152 440 204 530 622
Base content per 1 kb (bases) 359 641 245 114 295 346
Base content (%) 35.9% 64.1%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 206 313 151 55 79 234
Base content per 1 kb (bases) 397 603 291 106 152 451
Base content (%) 39.7% 60.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 9 9 8 19 1 20 8 1 2 3 2 1 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 6 6 1 2 1 8 0 3 2 10 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 1 3 4 0 0 3 2 1 1 1 4 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 3 0 0 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 70 71 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 61 33 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 49 111 57
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPDPWFFILFMSWFVYLIILMPKTNNLKTSNEPTMQQNQNKPEPLIWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 2 (3.7%)
Threonine (Thr, T)
n = 4 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 4 (7.41%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 1 (1.85%)
Tryptophan (Trp, W)
n = 4 (7.41%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 2 (3.7%)
Asparagine (Asn, N)
n = 6 (11.11%)
Glutamine (Gln, Q)
n = 4 (7.41%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 1 1 2 0 2 4 0 1 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 1 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 0 1 1 0 0 0 1 0 0 0 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 21 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 14 18 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 8 30 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 43 (8.37%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 36 (7.0%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 62 (12.06%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 29 (5.64%)
Phenylalanine (Phe, F)
n = 39 (7.59%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 8 (1.56%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 8 24 13 10 16 3 20 6 1 12 4 18 2 23 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 8 19 13 3 7 11 24 4 10 6 11 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 20 0 9 5 13 1 1 3 10 9 0 0 11 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 2 8 7 8 0 1 0 7 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 105 135 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 125 206 158
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.14%)
Leucine (Leu, L)
n = 25 (10.96%)
Isoleucine (Ile, I)
n = 22 (9.65%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 7 (3.07%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 7 (3.07%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 11 3 1 10 1 9 8 1 2 3 9 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 7 6 0 1 1 6 0 1 3 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 3 5 7 0 1 2 4 3 0 1 4 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 2 5 6 3 0 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 51 68 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 63 57 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 54 111 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 10 7 3 12 2 8 7 0 4 5 5 2 19 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 7 7 0 0 8 12 0 1 4 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 1 3 3 7 0 1 3 6 3 1 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 0 1 4 2 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 64 60 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 63 54 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 74 113 67
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 14 (3.69%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 11 16 11 4 13 1 27 5 2 6 1 8 0 21 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 9 11 0 2 5 16 3 1 3 17 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 2 6 3 12 0 0 2 7 7 0 1 11 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 4 5 10 0 0 1 6 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 81 113 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 98 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 90 172 103
ND1 (size: 960 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.64%)
Alanine (Ala, A)
n = 23 (7.21%)
Serine (Ser, S)
n = 27 (8.46%)
Threonine (Thr, T)
n = 26 (8.15%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.7%)
Leucine (Leu, L)
n = 59 (18.5%)
Isoleucine (Ile, I)
n = 22 (6.9%)
Methionine (Met, M)
n = 21 (6.58%)
Proline (Pro, P)
n = 19 (5.96%)
Phenylalanine (Phe, F)
n = 19 (5.96%)
Tyrosine (Tyr, Y)
n = 9 (2.82%)
Tryptophan (Trp, W)
n = 7 (2.19%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.45%)
Asparagine (Asn, N)
n = 13 (4.08%)
Glutamine (Gln, Q)
n = 7 (2.19%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 19 9 11 17 0 22 7 0 3 3 8 1 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 9 12 0 1 4 12 1 5 2 10 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 0 5 5 13 0 2 2 8 1 0 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 3 0 7 0 0 2 6 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 75 93 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 91 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 69 168 76
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 32 (9.25%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 8 31 12 10 21 4 15 10 1 1 0 5 0 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 9 9 1 1 4 9 1 0 5 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 0 5 4 16 1 1 3 5 1 0 1 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 12 1 0 1 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 88 136 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 109 60 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 76 186 74
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 32 (9.25%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 8 31 12 10 21 4 15 10 1 1 0 5 0 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 9 9 1 1 4 9 1 0 5 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 0 5 4 16 1 1 3 5 1 0 1 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 12 1 0 1 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 88 136 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 109 60 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 76 186 74
ND4 (size: 1372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.61%)
Alanine (Ala, A)
n = 29 (6.36%)
Serine (Ser, S)
n = 35 (7.68%)
Threonine (Thr, T)
n = 49 (10.75%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 14 (3.07%)
Leucine (Leu, L)
n = 92 (20.18%)
Isoleucine (Ile, I)
n = 40 (8.77%)
Methionine (Met, M)
n = 29 (6.36%)
Proline (Pro, P)
n = 22 (4.82%)
Phenylalanine (Phe, F)
n = 18 (3.95%)
Tyrosine (Tyr, Y)
n = 12 (2.63%)
Tryptophan (Trp, W)
n = 14 (3.07%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 11 (2.41%)
Asparagine (Asn, N)
n = 19 (4.17%)
Glutamine (Gln, Q)
n = 13 (2.85%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 8 26 19 13 26 3 28 13 0 2 2 10 0 15 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 5 13 11 0 1 7 10 3 0 6 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 0 8 8 10 0 2 7 7 5 1 3 7 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 1 1 9 3 1 0 9 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 117 158 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 126 80 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 117 214 108
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 14 (14.29%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 2 (2.04%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 6 3 3 9 1 6 2 0 1 0 1 0 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 3 3 0 1 0 1 1 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 2 3 3 0 1 1 1 1 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 2 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 26 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 17 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 27 46 21
ND5 (size: 1796 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.69%)
Alanine (Ala, A)
n = 41 (6.87%)
Serine (Ser, S)
n = 43 (7.2%)
Threonine (Thr, T)
n = 66 (11.06%)
Cysteine (Cys, C)
n = 8 (1.34%)
Valine (Val, V)
n = 21 (3.52%)
Leucine (Leu, L)
n = 92 (15.41%)
Isoleucine (Ile, I)
n = 55 (9.21%)
Methionine (Met, M)
n = 41 (6.87%)
Proline (Pro, P)
n = 24 (4.02%)
Phenylalanine (Phe, F)
n = 37 (6.2%)
Tyrosine (Tyr, Y)
n = 8 (1.34%)
Tryptophan (Trp, W)
n = 12 (2.01%)
Aspartic acid (Asp, D)
n = 11 (1.84%)
Glutamic acid (Glu, E)
n = 13 (2.18%)
Asparagine (Asn, N)
n = 35 (5.86%)
Glutamine (Gln, Q)
n = 19 (3.18%)
Histidine (His, H)
n = 10 (1.68%)
Lysine (Lys, K)
n = 26 (4.36%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 16 37 17 10 32 3 23 19 0 8 3 8 2 25 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 7 4 20 17 0 3 6 16 3 5 6 13 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 31 2 6 9 18 0 3 7 2 6 0 7 19 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 2 6 5 25 1 1 2 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 123 233 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 164 122 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 153 267 154
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.37%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 1 (0.58%)
Cysteine (Cys, C)
n = 3 (1.74%)
Valine (Val, V)
n = 27 (15.7%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 8 (4.65%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 2 (1.16%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 5 8 0 0 1 14 1 1 13 0 8 6 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 0 7 2 1 4 8 1 1 13 2 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 10 0 2 0 2 1 9 0 3 7 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 3 0 0 1 3 0 0 0 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 18 23 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 31 21 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 6 35 89
Total protein-coding genes (size: 11340 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.96%)
Alanine (Ala, A)
n = 259 (6.86%)
Serine (Ser, S)
n = 270 (7.15%)
Threonine (Thr, T)
n = 338 (8.95%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 179 (4.74%)
Leucine (Leu, L)
n = 621 (16.44%)
Isoleucine (Ile, I)
n = 310 (8.21%)
Methionine (Met, M)
n = 234 (6.2%)
Proline (Pro, P)
n = 201 (5.32%)
Phenylalanine (Phe, F)
n = 229 (6.06%)
Tyrosine (Tyr, Y)
n = 101 (2.67%)
Tryptophan (Trp, W)
n = 106 (2.81%)
Aspartic acid (Asp, D)
n = 68 (1.8%)
Glutamic acid (Glu, E)
n = 99 (2.62%)
Asparagine (Asn, N)
n = 148 (3.92%)
Glutamine (Gln, Q)
n = 99 (2.62%)
Histidine (His, H)
n = 95 (2.52%)
Lysine (Lys, K)
n = 91 (2.41%)
Arginine (Arg, R)
n = 68 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
229 81 202 117 79 183 23 198 92 7 55 24 85 15 172 57
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 10 18 44 107 99 9 27 50 118 30 30 38 124 9 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
109 175 7 60 50 109 3 14 34 63 38 6 21 76 72 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 86 13 36 32 85 6 7 11 48 2 1 0 6 1 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
830 865 1170 912
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
476 1020 708 1573
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
184 870 1711 1012

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.