Viewing data for Vulpes corsac


Scientific name Vulpes corsac
Common name Corsac fox
Maximum lifespan 13.00 years (Vulpes corsac@AnAge)

Total mtDNA (size: 16721 bases) GC AT G C A T
Base content (bases) 6800 9921 4327 2473 4674 5247
Base content per 1 kb (bases) 407 593 259 148 280 314
Base content (%) 40.7% 59.3%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4647 6691 3091 1556 3286 3405
Base content per 1 kb (bases) 410 590 273 137 290 300
Base content (%) 41.0% 59.0%
D-loop (size: 1259 bases) GC AT G C A T
Base content (bases) 579 680 377 202 310 370
Base content per 1 kb (bases) 460 540 299 160 246 294
Base content (%) 46.0% 54.0%
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 550 965 311 239 439 526
Base content per 1 kb (bases) 363 637 205 158 290 347
Base content (%) 36.3% 63.7%
Total rRNA-coding genes (size: 2538 bases) GC AT G C A T
Base content (bases) 992 1546 529 463 627 919
Base content per 1 kb (bases) 391 609 208 182 247 362
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 384 573 207 177 227 346
Base content per 1 kb (bases) 401 599 216 185 237 362
Base content (%) 40.1% 59.9%
16S rRNA gene (size: 1581 bases) GC AT G C A T
Base content (bases) 608 973 322 286 400 573
Base content per 1 kb (bases) 385 615 204 181 253 362
Base content (%) 38.5% 61.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 282 399 194 88 201 198
Base content per 1 kb (bases) 414 586 285 129 295 291
Base content (%) 41.4% 58.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 80 124 57 23 52 72
Base content per 1 kb (bases) 392 608 279 113 255 353
Base content (%) 39.2% 60.8%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 652 893 368 284 485 408
Base content per 1 kb (bases) 422 578 238 184 314 264
Base content (%) 42.2% 57.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 270 414 167 103 194 220
Base content per 1 kb (bases) 395 605 244 151 284 322
Base content (%) 39.5% 60.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 350 434 224 126 229 205
Base content per 1 kb (bases) 446 554 286 161 292 261
Base content (%) 44.6% 55.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 469 671 315 154 336 335
Base content per 1 kb (bases) 411 589 276 135 295 294
Base content (%) 41.1% 58.9%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 405 551 289 116 277 274
Base content per 1 kb (bases) 424 576 302 121 290 287
Base content (%) 42.4% 57.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 398 644 288 110 286 358
Base content per 1 kb (bases) 382 618 276 106 274 344
Base content (%) 38.2% 61.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 145 201 99 46 94 107
Base content per 1 kb (bases) 419 581 286 133 272 309
Base content (%) 41.9% 58.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 559 819 389 170 400 419
Base content per 1 kb (bases) 406 594 282 123 290 304
Base content (%) 40.6% 59.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 117 180 66 51 100 80
Base content per 1 kb (bases) 394 606 222 172 337 269
Base content (%) 39.4% 60.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 743 1078 507 236 533 545
Base content per 1 kb (bases) 408 592 278 130 293 299
Base content (%) 40.8% 59.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 203 325 146 57 118 207
Base content per 1 kb (bases) 384 616 277 108 223 392
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 10 6 5 15 3 8 7 2 3 2 3 2 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 8 6 3 1 1 2 6 2 2 8 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 5 1 4 0 2 1 1 1 0 5 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 2 0 1 3 1 0 1 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 63 80 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 67 80 57
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWLVMILSMILTLFILFQLKVSKHYYPENPGLKSIKSTSKRTPWENKWTKIYSPLSLPPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 2 1 4 1 2 1 2 1 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 1 2 1 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 1 1 1 3 2 0 1 1 2 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 5 2 0 1 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 20 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 17 28 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 21 11 2 21 5 14 5 2 8 8 17 4 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 15 10 12 2 14 7 19 7 9 9 7 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 6 9 6 10 2 2 1 8 11 2 6 8 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 2 10 5 6 3 2 0 3 3 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 100 139 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 97 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 135 172 149
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 5 13 4 4 9 5 11 7 0 6 4 5 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 1 4 1 3 0 3 4 1 2 1 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 0 6 3 4 0 1 3 6 5 0 0 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 5 4 6 3 1 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 55 67 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 58 92 57
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 7 9 4 6 15 3 3 7 0 4 8 6 0 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 8 1 0 2 6 7 6 2 3 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 7 6 4 1 0 3 9 5 1 0 4 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 0 3 1 1 1 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 68 59 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 58 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 91 88 63
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 13 (3.43%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 22 13 9 11 23 1 9 3 3 3 5 8 1 12 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 4 6 15 0 2 4 16 3 7 6 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 6 6 10 1 1 1 8 6 1 1 3 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 2 11 8 1 2 0 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 93 110 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 127 148 89
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 9 (2.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 15 12 9 15 20 2 9 5 1 1 5 6 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 14 9 0 2 2 8 0 4 9 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 4 5 11 0 1 1 4 7 0 2 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 7 0 1 2 3 3 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 86 91 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 91 54 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 112 128 63
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 37 (10.69%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 32 6 9 31 4 2 7 2 3 7 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 0 7 11 3 2 4 9 0 5 7 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 1 4 13 9 2 2 1 2 7 0 2 7 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 13 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 59 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 97 159 69
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 37 (10.69%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 32 6 9 31 4 2 7 2 3 7 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 0 7 11 3 2 4 9 0 5 7 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 1 4 13 9 2 2 1 2 7 0 2 7 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 13 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 59 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 97 159 69
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 20 23 19 10 39 14 10 7 4 0 2 7 2 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 5 10 12 3 1 9 5 2 8 7 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 1 10 7 8 2 4 6 6 11 1 3 9 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 3 3 1 12 1 1 2 5 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 137 162 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 119 85 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 133 172 107
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 7 2 1 6 6 5 2 0 1 1 4 3 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 2 1 2 0 2 1 1 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 3 3 0 0 1 3 1 0 2 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 21 28 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 25 34 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 45 (7.43%)
Serine (Ser, S)
n = 54 (8.91%)
Threonine (Thr, T)
n = 50 (8.25%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 22 (3.63%)
Leucine (Leu, L)
n = 86 (14.19%)
Isoleucine (Ile, I)
n = 56 (9.24%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 41 (6.77%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 26 (4.29%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 18 (2.97%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 25 33 18 19 33 6 9 16 3 7 3 10 2 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 4 6 21 18 0 5 8 10 6 7 9 6 3 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 2 7 13 16 4 7 7 10 10 3 1 10 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 3 5 7 19 5 1 4 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 148 212 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 160 130 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 199 203 157
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 10 (5.71%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 3 0 0 1 2 12 0 1 8 0 6 8 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 4 3 0 3 11 2 4 5 2 0 1 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 4 1 1 0 4 1 6 3 3 6 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 1 0 4 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 8 49 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 31 32 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 18 37 76
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 257 (6.76%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 303 (7.98%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 191 (5.03%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 340 (8.95%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 195 (5.13%)
Phenylalanine (Phe, F)
n = 225 (5.92%)
Tyrosine (Tyr, Y)
n = 136 (3.58%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 74 (1.95%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 147 (3.87%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 102 (2.68%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
189 151 186 93 89 228 54 96 68 21 46 45 76 24 100 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
65 6 18 55 95 90 17 40 51 89 35 52 61 72 10 75
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
99 113 16 67 66 85 15 24 29 66 70 12 29 58 89 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 69 26 31 43 80 22 9 11 38 10 1 0 7 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
832 917 1197 854
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 988 751 1596
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
356 1115 1390 939

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.